NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS21896.1 (previous version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
21896.1 Public Mus musculus 7 Rgs10 13 103 72 CCDS HistoryNCBI Gene:67865Re-query CCDS DB by CCDS ID:21896.1Re-query CCDS DB by GeneID:67865

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 21896.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000033133 ENSMUSP00000033133 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000033133Link to Ensembl Protein Viewer:ENSMUSP00000033133Re-query CCDS DB by Nucleotide ID:ENSMUST00000033133Re-query CCDS DB by Protein ID:ENSMUSP00000033133
Original member Current member EBI,WTSI OTTMUST00000055088 OTTMUSP00000026329 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000055088Link to Vega Protein Viewer:OTTMUSP00000026329Re-query CCDS DB by Nucleotide ID:OTTMUST00000055088Re-query CCDS DB by Protein ID:OTTMUSP00000026329
Original member Current member NCBI NM_026418.2 NP_080694.1 Accepted alive Link to Nucleotide Sequence:NM_026418.2Link to Protein Sequence:NP_080694.1Re-query CCDS DB by Nucleotide ID:NM_026418Re-query CCDS DB by Protein ID:NP_080694Link to BLAST:NP_080694.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_080694.1 181 Q9CQE5 181 100% 0 0

Chromosomal Locations for CCDS 21896.1

Assembly GRCm38.p1 (GCF_000001635.21)

On '-' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

Chromosome Start Stop Links
7 128373896 128374042 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 128388964 128389107 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 128403170 128403256 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 128404359 128404477 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 128418066 128418114 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (546 nt):
ATGTTCACCCGCGCCGTGAGCCGACTGAGCAGGAAGCGGCCGCCGTCTGATATCCATGACGGAGATGGGA
GC
TCAAGCAGCGGCCACCAGAGCCTTAAGAGCACAGCCAAGTGGGCATCCTCCCTGGAGAATCTTCTGGA
A
GACCCAGAAGGGGTGCAGAGATTCAGGGAGTTTCTGAAGAAGGAATTCAGCGAAGAGAATGTCTTGTTT
TGG
CTAGCGTGTGAAGATTTCAAGAAAACGGAGGACAGGAAGCAGATGCAGGAAAAGGCCAAGGAGATCT
AC
ATGACCTTCCTGTCCAATAAGGCCTCTTCACAAGTCAACGTGGAGGGGCAGTCTCGGCTCACTGAAAA
G
ATTCTGGAAGAGCCACACCCTCTGATGTTCCAAAAGCTCCAGGACCAGATCTTCAATCTCATGAAGTAT
GAC
AGCTACAGCCGCTTCTTGAAGTCTGACTTGTTTCTGAAACCCAAGCGAACTGAGGAAGAGGAAGAAG
AG
CCCCCGGATGCTCAGACCGCAGCTAAGCGAGCCTCCAGAATTTACAACACATAA


Translation (181 aa):
MFTRAVSRLSRKRPPSDIHDGDGSSSSGHQSLKSTAKWASSLENLLEDPEGVQRFREFLKKEFSEENVLF
W
LACEDFKKTEDRKQ
MQEKAKEIYMTFLSNKASSQVNVEGQSRLTEKILEEPHPLMFQKLQDQIFNLMKY
D
SYSRFLKSDLFLKPKRTEEEEEEPPDAQTAAKRASRIYNT




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser