NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS21524.2 (previous version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
21524.2 Public Mus musculus 7 Xntrpc 13 103 72 CCDS HistoryNCBI Gene:102443351Re-query CCDS DB by CCDS ID:21524.2Re-query CCDS DB by GeneID:102443351

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Public Note for CCDS 21524.1
The coding region has been updated to extend the N-terminus to one that is more supported by available conservation data and publications.

Sequence IDs included in CCDS 21524.2

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000084843 ENSMUSP00000081903 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000084843Link to Ensembl Protein Viewer:ENSMUSP00000081903Re-query CCDS DB by Nucleotide ID:ENSMUST00000084843Re-query CCDS DB by Protein ID:ENSMUSP00000081903
Original member Current member EBI,WTSI ENSMUST00000094129 ENSMUSP00000091679 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000094129Link to Ensembl Protein Viewer:ENSMUSP00000091679Re-query CCDS DB by Nucleotide ID:ENSMUST00000094129Re-query CCDS DB by Protein ID:ENSMUSP00000091679
Original member EBI,WTSI OTTMUST00000054529 OTTMUSP00000026045 Accepted not alive Link to Vega Transcript Viewer:OTTMUST00000054529Link to Vega Protein Viewer:OTTMUSP00000026045Re-query CCDS DB by Nucleotide ID:OTTMUST00000054529Re-query CCDS DB by Protein ID:OTTMUSP00000026045
Original member NCBI NM_011644.2 NP_035774.2 Updated not alive Link to Nucleotide Sequence:NM_011644.2Link to Protein Sequence:NP_035774.2Re-query CCDS DB by Nucleotide ID:NM_011644Re-query CCDS DB by Protein ID:NP_035774
Current member NCBI NM_011644.3 NP_035774.2 Accepted alive Link to Nucleotide Sequence:NM_011644.3Link to Protein Sequence:NP_035774.2Re-query CCDS DB by Nucleotide ID:NM_011644Re-query CCDS DB by Protein ID:NP_035774Link to BLink:NP_035774.2

Chromosomal Locations for CCDS 21524.2

Assembly GRCm38.p1 (GCF_000001635.21)

On '+' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 7Link to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

Chromosome Start Stop Links
7 102071317 102071361 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 102073175 102073316 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 102075797 102075952 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 102077749 102077927 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 102078733 102078818 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 102079005 102079177 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 102080529 102080604 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 102081483 102081610 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 102082041 102082146 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 102082973 102083018 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 102083861 102084580 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 102086398 102086610 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 102087516 102087680 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 102088116 102088290 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 102089101 102089301 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 102089913 102090075 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 102090523 102090615 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 102093530 102093722 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 102094228 102094355 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 102094495 102094573 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 102095168 102095300 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 102095857 102096251 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3795 nt):
ATGGCTCCTGTGAAGATCAGCCATGTGGTGTCATTTTCCTCTCAGGATCCCAAATATCCTGTGGAGAACT
TG
CTGAACCCAGACAGTCACAGGGGACCCTGGCTCAGCTGCCCTCAGGACAAGACTGGACAACTGAAAGT
G
GAGTTTCAGCTGGAGAGGGCAGTGCCCATAAGCTATATTGATGTTGGAAACTGTGGCTGTGCTTTCCTA
CAG
ATTGATGTGGGTCGTTCTTCCTGGCCCCTGGACAGACCTTTCGTCACCCTGCTCCCTGCCACCATGC
TA
ATGTCCCGCACTGACTCCAAGTCGGGGAAGAACCGCTCAGGGGTCCGGATGTTTAAAGATGGTGATTT
C
CTGACTCCAGCCTCAGGAGAGTCCTGGGATCGACTTCGATTGACCTGCTCCCAACCTTTCACACGTCAT
CAG
TCCTTTGGCCTGGCCTTCCTACGAGTGCGTTCCTCTCTGGGCTCTCTGGCTGACCCTGTAGTAGATC
CC
TCAGCCCCTGGGAGCTCTGGGCTTAACCAGAACTCTACAGATGTGCTGGAGTCTGATCCTAGGCCCTG
G
CTGACTAATCCTTCTATCCGGAGGACATTCTTCCCCGATCCCCAGACGAGCACCAAGGAAATTTCAGAG
CTC
AAGGGTATGTTGAAGCAGTTGCAGCCAGGGCCTCTGGGGCGGGCAGCCCGCATGGTGCTTTCTGCTG
CC
CGTAAGGCCCCTCCAGCCAGTGTGGTAAGCCCAAACAACAGCCACGGAGAACCAGGTCCCAGCCGTGC
A
GAGAGTGCAGAGCCCAGAGCAGAAGAACCAAACAGGAAGACGGCTGTGGGCAGAAGGAAGAGGAGGAAA
GTG
CAGGAGCCAAGGAGATCGTTGTCCAACTCGAGTTCTCAGCCAAATAGGAGGACAGGAAGGACAAGAC
AA
AGACAGCACCGACCTCAGACCAAAAGTGATGACGGTGGTGTGCAGGCTGCTGGACAGTGTCCTATTTG
T
GCAGGTTTCTTCAGTATTGAGACTCTTCCCCAGCATGCTGCAACTTGTGGAGAGAGCCCCCCACCCCAG
CCA
GCTTCTCCTGCCTCCTTGTCTTCCTCGGAGTCCGTGCTGAGACGTCATCATGTGGCACTAACACCCG
TT
CCCCTTGTCCCCAAGCCACAGCCCAACTGGACTGAGATTGTGAACAAAAAGCTCAAATTCCCCCCCAC
A
CTCCTGCGTGCCATCCAGGAGGGCCAGCTGGGTCTTGTGCAGCAGCTGCTGGAATCCAGTTCCGATGCC
TCG
GGTGCTGGGCCAGGTGGTCCTCTGCGGAATGTGGAAGAGTCTGAGGACCGCTCCTGGAGGGAAGCCC
TC
AACCTGGCCATCCGCCTGGGCCACGAGGTCATCACTGATGTTCTGCTGGCCAATGTCAAATTCGACTT
T
CGGCAGATCCACGAAGCCCTGCTAGTGGCTGTGGACACAAACCAGCCAGCAGTGGTGCGTCGCCTGCTA
GCG
CGGCTGGAGCGGGAGAAAGGTCGAAAAGTAGACACCAAGTCTTTCTCTCTAGCCTTCTTTGACTCAT
CG
ATTGATGGCTCCCGCTTTGCCCCTGGTGTCACTCCACTCACACTGGCCTGCCAGAAGGACCTGTATGA
G
ATTGCCCAGCTGCTTATGGACCAGGGCCATACCATTGCTCGGCCCCACCCAGTTTCCTGTGCCTGCCTC
GAG
TGCAGCAATGCCCGCCGATACGACCTGCTGAAGTTCTCACTATCCCGAATCAACACCTACCGAGGCA
TT
GCAAGCCGGGCTCACCTCTCGCTGGCCAGTGAGGATGCCATGCTGGCCGCTTTTCAGCTCAGCCGGGA
G
CTCAGGCGCCTTGCACGAAAGGAGCCTGAGTTTAAGCCTCAGTACATTGCCCTGGAGTCTCTCTGCCAG
GAC
TATGGCTTCGAGTTGCTGGGCATGTGCCGAAATCAGAGTGAGGTCACCGCAGTGCTCAATGACCTGG
GT
GAGGATAGTGAGACTGAGCCTGAGGCTGAGGGCCTGGGTCAGGCCTTTGAGGAGGGCATCCCCAACCT
G
GCAAGACTGCGGTTGGCTGTCAACTACAACCAGAAACAGTTTGTAGCACATCCCATCTGCCAGCAAGTT
CTG
TCTTCCATCTGGTGTGGGAACCTGGCTGGCTGGCGTGGAAGCACCACCATCTGGAAGCTCTTTGTTG
CC
TTCCTCATCTTCCTCACCATGCCCTTCCTCTGCATTGGCTACTGGCTGGCGCCCAAGTCCCAGCTGGG
C
CGCCTGCTGAAGATCCCGGTGCTGAAGTTCCTGCTGCATTCTGCCTCCTACCTGTGGTTCCTTATCTTC
TTG
CTGGGAGAGTCTCTGGTCATGGAGACCCAGCTGAGCACCTTCAAAGGCCGCAGCCAGAGTGTCTGGG
AG
ACTTCACTACATATGATCTGGGTCACAGGCTTCCTATGGTTTGAATGCAAGGAGGTGTGGATCGAGGG
C
TTGCGGAGCTACCTCCTGGACTGGTGGAACTTCCTGGACGTGGTCATCCTGTCCCTGTACTTGGCATCC
TTT
GCACTGCGCCTCCTCCTGGCTGGGCTTGCCTACATGCACTGCCGTGATGCCTCAGACAGCACCACCT
GC
CGCTATTTCACCACAGCTGAGAGAAGTGAGTGGCGTACAGAGGACCCCCAGTTTCTGGCTGAGGTGCT
C
TTTGCTGTCACCAGCATGCTCAGCTTCACCCGACTGGCATATATTCTGCCAGCTCACGAATCGCTGGGC
ACA
CTGCAGATCTCCATCGGCAAGATGATTGACGACATGATCCGGTTCATGTTCATCCTCATGATCATCC
TG
ACTGCCTTCCTCTGTGGCCTCAACAACATCTATGTGCCCTACCAGGAATCCGAGAAGCTAGGCAATTT
C
AACGAAACGTTCCAGTTTCTCTTTTGGACCATGTTCGGCATGGAAGAGCACACAGTGGTGGACATGCCT
CAG
TTCCTGGTGCCTGAGTTCGTGGGCAGGGCCATGTACGGCATCTTTACCATCGTCATGGTCATTGTGC
TA
CTTAACATGCTTATTGCCATGATCACCAACTCCTTCCAGAAGATCGAGGATGATGCTGATGTGGAGTG
G
AAGTTTGCTCGCTCCAAGCTCTACCTGTCCTACTTCCGAGAGGGTCTGACGCTGCCTGTGCCCTTTAAC
ATC
CTGCCATCCCCAAAGGCCGCCTTCTACCTCGTCAGGAGAATTTTCCGGTTCCTTTGCTGTGGCTCCT
CC
TGCTGCAAAGCCAAGAAGTCGGACTACCCGCCCATCGGGACCTTTACCAACCCCGGGGCAAGGGCGGG
C
TCCGCCGGGGAAGGAGAACGCGTGTCCTACCGCCTTCGAGTCATCAAGGCTCTGGTGCAGCGCTACATA
GAG
ACTGCCCGGCGCGAGTTCGAGGAGACCCGTCGGAAAGACCTGGGCAACAGACTGACAGAGCTGACCA
AG
ACTGTGTCTCGACTGCAAAGCGAGGTGGCCAGTGTGCAGAAGAACCTGGCGGCGGGAGGGGCACCACG
G
CCTCCGGATGGTGCCAGCATCCTCAGTAGATACATCACCCGAGTGCGCAACAGCTTCCAGAACCTGGGC
CCC
CCTACCTCTGACACCCCAGCAGAGCTGACTATGCCTGGGATTGTGGAGACCGAAGTCTCTTTAGGAG
AT
GGCCTTGATGGCACAGGTGAAGCTGGAGCTCCCGCTCCTGGAGAGCCCGGCTCTTCCTCCTCTGCCCA
T
GTGCTGGTTCACAGGGAGCAAGAAGCAGAGGGGTCAGGGGACTTGCTCCTGGAAGGAGATCTGGAGACC
AAG
GGCGAGTCCTAA


Translation (1264 aa):
MAPVKISHVVSFSSQDPKYPVENLLNPDSHRGPWLSCPQDKTGQLKVEFQLERAVPISYIDVGNCGCAFL
Q
IDVGRSSWPLDRPFVTLLPATMLMSRTDSKSGKNRSGVRMFKD
GDFLTPASGESWDRLRLTCSQPFTRH
Q
SFGLAFLRVRSSLGSLADPVVDPSAPGSSGLNQ
NSTDVLESDPRPWLTNPSIRRTFFPDPQTSTKEISE
L
KGMLKQLQPGPLGRAARMVLSAARKAPPASVVSPNNSHGEPGPSRAESA
EPRAEEPNRKTAVGRRKRRK
V
QEPR
RSLSNSSSQPNRRTGRTRQRQHRPQTKSDDGGVQAAGQCPICAGFFSIETLPQHAATCGESPPPQ
P
ASPASLSSSESV
LRRHHVALTPVPLVPKPQPNWTEIVNKKLKFPPTLLRAIQEGQLGLVQQLLESSSDA
S
GAGPGGPLRNVEESEDRSWREALNLAIRLGHEVITDVLLANVKFDFRQIHEALLVAVDTNQPAVVRRLL
A
RLEREKGRKVDTKSFSLAFFDSSIDGSRFAPGVTPLTLACQKDLYEIAQLLMDQGHTIARPHPVSCACL
E
CSNARRYDLLKFSLSRINTYRGIASRAHLSLASEDAMLAAFQLSRELRRLARKEPEFK
PQYIALESLCQ
D
YGFELLGMCRNQSEVTAVLNDLGEDSETEPEAEGLGQAFEEGIPNLARLRLAVNYNQKQ
FVAHPICQQV
L
SSIWCGNLAGWRGSTTIWKLFVAFLIFLTMPFLCIGYWLAPKSQ
LGRLLKIPVLKFLLHSASYLWFLIF
L
LGESLVMETQLSTFKGRSQSVWETSLHMIWVT
GFLWFECKEVWIEGLRSYLLDWWNFLDVVILSLYLAS
F
ALRLLLAGLAYMHCRDASDSTTCRYFTTA
ERSEWRTEDPQFLAEVLFAVTSMLSFTRLAYILPAHESLG
T
LQISIGKMIDDMI
RFMFILMIILTAFLCGLNNIYVPYQESEKLGNFNETFQFLFWTMFGMEEHTVVDMP
Q
FLVPEFVGRAMYGIFTIVMVIVLLNMLIAMITNSFQKIE
DDADVEWKFARSKLYLSYFREGLTLPVPFN
I
LPSPKAAFYLV
RRIFRFLCCGSSCCKAKKSDYPPIGTFTNPGARAGSAGEGERVSYRLRVIKALVQRYI
E
TARREFEETRRK
DLGNRLTELTKTVSRLQSEVASVQKNLAAGGAPRPPDGASILSRYITRVRNSFQNLG
P
PTSDTPAELTMPGIVETEVSLGDGLDGTGEAGAPAPGEPGSSSSAHVLVHREQEAEGSGDLLLEGDLET
K
GES




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser