NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS17508.1 (previous version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
17508.1 Public Mus musculus 3 Shc1 13 103 72 CCDS HistoryNCBI Gene:20416Re-query CCDS DB by CCDS ID:17508.1Re-query CCDS DB by GeneID:20416

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 17508.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000039110 ENSMUSP00000035361 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000039110Link to Ensembl Protein Viewer:ENSMUSP00000035361Re-query CCDS DB by Nucleotide ID:ENSMUST00000039110Re-query CCDS DB by Protein ID:ENSMUSP00000035361
Original member Current member EBI,WTSI OTTMUST00000052403 OTTMUSP00000024847 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000052403Link to Vega Protein Viewer:OTTMUSP00000024847Re-query CCDS DB by Nucleotide ID:OTTMUST00000052403Re-query CCDS DB by Protein ID:OTTMUSP00000024847
Original member Current member NCBI NM_011368.5 NP_035498.2 Accepted alive Link to Nucleotide Sequence:NM_011368.5Link to Protein Sequence:NP_035498.2Re-query CCDS DB by Nucleotide ID:NM_011368Re-query CCDS DB by Protein ID:NP_035498Link to BLAST:NP_035498.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_035498.2 469 P98083-2 469 100% 0 0

Chromosomal Locations for CCDS 17508.1

Assembly GRCm38.p1 (GCF_000001635.21)

On '+' strand of Chromosome 3 (NC_000069.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3

Chromosome Start Stop Links
3 89422181 89422345 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 89422926 89422996 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 89423508 89423571 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 89423697 89423816 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 89424190 89424243 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 89424555 89424606 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 89424766 89424892 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 89426515 89426701 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 89426788 89426857 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 89426939 89427070 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 89427208 89427446 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 89428317 89428445 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1410 nt):
ATGAACAAGCTGAGTGGAGGCGGCGGGCGCAGGACTCGGGTAGAAGGGGGCCAGCTGGGGGGCGAGGAGT
GG
ACCAGACACGGGAGCTTTGTCAATAAGCCCACACGAGGCTGGCTGCATCCCAACGACAAAGTCATGGG
A
CCTGGGGTTTCCTACTTGGTTCGGTACATGGGCTGTGTGGAGGTCTTACAGTCAATGCGAGCCCTTGAC
TTC
AATACCCGGACTCAGGTCACCAGGGAGGCCATCAGTTTGGTGTGTGAAGCTGTGCCTGGTGCCAAAG
GG
GCGACAAGGAGGAGAAAGCCTTGTAGCCGCCCACTCAGCTCCATCCTGGGGAGGAGTAACCTGAAGTT
T
GCTGGAATGCCAATCACTCTCACTGTGTCTACCAGCAGCCTTAACCTCATGGCAGCCGACTGCAAACAG
ATC
ATTGCCAACCATCACATGCAATCTATCTCTTTCGCGTCCGGTGGGGATCCGGACACAGCTGAGTATG
TT
GCCTATGTTGCCAAAGACCCTGTGAATCAGAGAGCCTGCCATATCCTGGAGTGTCCTGAAGGGCTTGC
T
CAGGATGTCATCAGCACCATCGGGCAGGCCTTTGAGTTGCGCTTCAAACAGTATCTCAGGAATCCACCG
AAG
CTGGTCACCCCCCATGACAGGATGGCTGGCTTTGATGGCTCAGCTTGGGATGAGGAGGAAGAAGAGC
CC
CCTGACCATCAGTACTACAATGACTTTCCAGGGAAGGAACCCCCTCTTGGTGGGGTGGTAGATATGAG
G
CTTCGGGAAGGGGCTGCTCGACCCACTCTGCCTAGTGCCCAGATGTCCAGCCACTTGGGAGCTACACTG
CCT
ATAGGGCAGCATGCTGCAGGAGACCATGAAGTCCGTAAACAGATGTTGCCTCCGCCGCCTTGCCCAG
GC
AGAGAACTCTTCGATGACCCCTCCTATGTCAACATCCAGAATCTAGACAAGGCCCGGCAGGCTGGGGG
T
GGGGCTGGGCCCCCAAATCCTTCTCTTAATGGCAGTGCACCCCGAGACCTTTTTGACATGAAGCCCTTT
GAA
GATGCACTTCGGGTGCCACCCCCACCGCAGTCCATGTCCATGGCTGAGCAGCTGCAAGGGGAGCCCT
GG
TTCCACGGGAAGCTGAGCCGGAGGGAGGCCGAGGCGCTGCTGCAGCTCAATGGTGACTTCTTGGTGCG
A
GAGAGCACGACCACGCCTGGCCAGTATGTGCTCACTGGCCTGCAGAGTGGGCAGCCCAAGCACTTGCTG
CTG
GTGGACCCTGAAGGTGTGGTTCGGACAAAGGATCACCGCTTTGAGAGTGTCAGTCACCTGATCAGCT
AC
CACATGGACAATCACTTGCCCATCATCTCTGCGGGCAGCGAACTGTGCCTACAGCAACCCGTGGATCG
G
AAAGTGTGA


Translation (469 aa):
MNKLSGGGGRRTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALD
F
NTRTQVT
REAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSSLNLMAADCKQ
I
IANHHMQSISFASGGDP
DTAEYVAYVAKDPVNQRACHILECPEGLAQDVISTIGQAFELRFKQYLRNPP
K
LVTPHD
RMAGFDGSAWDEEEEEPPDHQYYNDFPGKEPPLGGVVDMRLREGAARPTLPSAQMSSHLGATL
P
IGQHAAGDHEVRKQMLPPPPCP
GRELFDDPSYVNIQNLDKARQAGGGAGPPNPSLNGSAPRDLFDMKPF
E
DALRVPPPPQSMSMAEQLQGEPWFHGKLSRREAEALLQLNGDFLVRESTTTPGQYVLTGLQSGQPKHLL
L
VDPEGV
VRTKDHRFESVSHLISYHMDNHLPIISAGSELCLQQPVDRKV



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser