NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS29372.1 (previous version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
29372.1 Public Mus musculus 18 Galr1 13 103 72 CCDS HistoryNCBI Gene:14427Re-query CCDS DB by CCDS ID:29372.1Re-query CCDS DB by GeneID:14427

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 29372.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000065224 ENSMUSP00000066381 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000065224Link to Ensembl Protein Viewer:ENSMUSP00000066381Re-query CCDS DB by Nucleotide ID:ENSMUST00000065224Re-query CCDS DB by Protein ID:ENSMUSP00000066381
Original member Current member NCBI NM_008082.2 NP_032108.1 Accepted alive Link to Nucleotide Sequence:NM_008082.2Link to Protein Sequence:NP_032108.1Re-query CCDS DB by Nucleotide ID:NM_008082Re-query CCDS DB by Protein ID:NP_032108Link to BLink:NP_032108.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_032108.1 348 P56479 348 100% 0 0

Chromosomal Locations for CCDS 29372.1

Assembly GRCm38.p1 (GCF_000001635.21)

On '-' strand of Chromosome 18 (NC_000084.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 18Link to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18

Chromosome Start Stop Links
18 82393693 82394010 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 82401800 82401865 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 82405488 82406150 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1047 nt):
ATGGAACTGGCTATGGTGAACCTCAGTGAAGGGAATGGGAGCGACCCAGAGCCGCCAGCCCCGGAGTCCA
GG
CCGCTCTTCGGCATTGGCGTGGAGAACTTCATTACGCTGGTAGTGTTTGGCCTGATTTTCGCGATGGG
C
GTGCTGGGCAACAGCCTGGTGATCACCGTGCTGGCGCGCAGCAAACCAGGCAAGCCGCGCAGCACCACC
AAC
CTGTTTATCCTCAATCTGAGCATCGCAGACCTGGCCTACCTGCTCTTCTGCATCCCTTTTCAGGCCA
CC
GTGTATGCACTGCCCACCTGGGTGCTGGGCGCCTTCATCTGCAAGTTTATACACTACTTCTTCACCGT
G
TCCATGCTGGTGAGCATCTTCACCCTGGCCGCGATGTCTGTGGATCGCTACGTGGCCATTGTGCACTCG
CGG
CGCTCCTCCTCCCTCAGGGTGTCCCGCAACGCACTGCTGGGCGTGGGCTTCATCTGGGCGCTGTCCA
TC
GCCATGGCCTCGCCGGTGGCCTACCACCAGCGTCTTTTCCATCGGGACAGCAACCAGACCTTCTGCTG
G
GAGCAGTGGCCCAACAAGCTCCACAAGAAGGCTTACGTGGTGTGCACTTTCGTCTTTGGGTACCTTCTG
CCC
TTACTGCTCATCTGCTTTTGCTATGCCAAGGTCCTTAATCATCTGCATAAAAAGCTGAAAAACATGT
CA
AAAAAGTCTGAAGCATCCAAGAAAAAGACTGCACAGACCGTCCTGGTGGTCGTTGTAGTATTTGGCAT
A
TCCTGGCTGCCCCATCATGTCGTCCACCTCTGGGCTGAGTTTGGAGCCTTCCCACTGACGCCAGCTTCC
TTC
TTCTTCAGAATCACCGCCCATTGCCTGGCATACAGCAACTCCTCAGTGAACCCCATCATATATGCCT
TT
CTCTCAGAAAACTTCCGGAAGGCGTACAAGCAAGTGTTCAAGTGTCATGTTTGCGATGAATCTCCACG
C
AGTGAAACTAAGGAAAACAAGAGCCGGATGGACACCCCGCCATCCACCAACTGCACCCACGTGTGA


Translation (348 aa):
MELAMVNLSEGNGSDPEPPAPESRPLFGIGVENFITLVVFGLIFAMGVLGNSLVITVLARSKPGKPRSTT
N
LFILNLSIADLAYLLFCIPFQATVYALPTWVLGAFICKFIHYFFTVSMLVSIFTLAAMSVDRYVAIVHS
R
RSSSLRVSRNALLGVGFIWALSIAMASPVAYHQRLFHRDSNQTFCWEQWPNKLHKKAYVVCTFVFGYLL
P
LLLICFCYAK
VLNHLHKKLKNMSKKSEASKKKTAQTVLVVVVVFGISWLPHHVVHLWAEFGAFPLTPAS
F
FFRITAHCLAYSNSSVNPIIYAFLSENFRKAYKQVFKCHVCDESPRSETKENKSRMDTPPSTNCTHV




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser