NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS26462.1 (previous version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
26462.1 Public Mus musculus 13 Bmp6 13 103 72 CCDS HistoryNCBI Gene:12161Re-query CCDS DB by CCDS ID:26462.1Re-query CCDS DB by GeneID:12161

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 26462.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000171970 ENSMUSP00000126999 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000171970Link to Ensembl Protein Viewer:ENSMUSP00000126999Re-query CCDS DB by Nucleotide ID:ENSMUST00000171970Re-query CCDS DB by Protein ID:ENSMUSP00000126999
Original member NCBI NM_007556.2 NP_031582.1 Accepted not alive Link to Nucleotide Sequence:NM_007556.2Link to Protein Sequence:NP_031582.1Re-query CCDS DB by Nucleotide ID:NM_007556Re-query CCDS DB by Protein ID:NP_031582Link to BLink:NP_031582.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_031582.1 510 P20722 510 100% 0 0

Chromosomal Locations for CCDS 26462.1

Assembly GRCm38.p1 (GCF_000001635.21)

On '+' strand of Chromosome 13 (NC_000079.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 13Link to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13

Chromosome Start Stop Links
13 38345933 38346587 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 38469614 38469806 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 38484891 38485039 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 38485739 38485936 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 38497295 38497371 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 38498717 38498827 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 38498919 38499068 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1533 nt):
ATGCCCGGGCTGGGGCGGAGGGCGCAGTGGCTGTGCTGGTGGTGGGGGTTGCTGTGCAGCTGCGGCCCCC
CG
CCACTGCGGCCCCCTCTGCCGGTAGCCGCGGCCGCCGCCGGGGGGCAGCTGCTGGGAGCCGGCGGGAG
C
CCGGTGCGCGCTGAGCAGCCACCGCCACAGTCCTCTTCTTCGGGCTTCCTCTATCGGCGGCTCAAGACC
CAC
GAGAAGCGGGAGATGCAAAAGGAGATCCTGTCGGTGCTGGGGCTCCCGCACAGGCCGCGGCCCCTGC
AC
GGTCTCCAGCAGCCTCAGCCCCCGGTGCTCCCGCCACAGCAGCAGCAGCAGCAGCAGCAGCAGCAGAC
G
GCCCGCGAGGAGCCCCCTCCAGGGCGGCTGAAGTCCGCTCCACTCTTCATGCTGGATCTCTACAACGCC
CTG
TCCAATGACGACGAAGAGGATGGGGCATCGGAGGGTGTGGGGCAAGAGCCTGGGTCCCACGGAGGGG
CC
AGCTCGTCCCAGCTCAGGCAGCCGTCTCCCGGCGCTGCACACTCCTTGAACCGCAAGAGTCTCCTGGC
C
CCGGGACCCGGTGGCGGTGCGTCCCCACTGACTAGCGCGCAGGACAGCGCTTTCCTCAACGACGCGGAC
ATG
GTCATGAGCTTTGTGAACCTGGTGGAGTACGACAAGGAGTTCTCCCCACATCAACGACACCACAAAG
AG
TTCAAGTTCAACCTATCCCAGATTCCTGAGGGTGAGGCGGTGACGGCTGCTGAGTTCCGCGTCTACAA
G
GACTGTGTGGTGGGGAGTTTTAAAAACCAAACCTTTCTTATCAGCATTTACCAAGTCTTGCAGGAGCAT
CAG
CACAGAGACTCTGACCTATTTTTGTTGGACACCCGGGTGGTGTGGGCCTCAGAAGAAGGTTGGCTGG
AA
TTTGACATCACAGCAACTAGCAATCTGTGGGTGGTGACACCGCAGCACAACATGGGGCTCCAGCTGAG
T
GTGGTGACTCGGGATGGACTCCACGTCAACCCCCGTGCGGCGGGCCTGGTGGGCAGAGACGGCCCTTAC
GAC
AAGCAGCCCTTCATGGTGGCCTTCTTCAAGGTGAGCGAGGTCCACGTGCGCACCACCAGGTCAGCCT
CC
AGTCGGCGGCGGCAGCAGAGTCGCAACCGGTCCACCCAGTCGCAGGACGTGTCCCGGGGCTCCGGTTC
T
TCAGACTACAACGGCAGTGAGTTAAAAACAGCTTGCAAGAAGCATGAGCTCTATGTGAGCTTCCAGGAC
CTG
GGATGGCAGGACTGGATCATTGCACCCAAAGGCTACGCTGCCAACTACTGTGATGGAGAGTGTTCCT
TC
CCACTCAACGCACACATGAATGCCACCAACCACGCCATTGTACAGACCTTGGTCCACCTTATGAATCC
C
GAGTACGTCCCCAAACCATGCTGCGCACCAACCAAACTGAATGCCATCTCGGTTCTTTACTTCGATGAT
AAC
TCCAATGTCATCTTGAAAAAGTACAGGAATATGGTCGTGAGAGCTTGTGGTTGCCATTAA


Translation (510 aa):
MPGLGRRAQWLCWWWGLLCSCGPPPLRPPLPVAAAAAGGQLLGAGGSPVRAEQPPPQSSSSGFLYRRLKT
H
EKREMQKEILSVLGLPHRPRPLHGLQQPQPPVLPPQQQQQQQQQQTAREEPPPGRLKSAPLFMLDLYNA
L
SNDDEEDGASEGVGQEPGSHGGASSSQLRQPSPGAAHSLNRKSLLAPGPGGGASPLTSAQDSAFLNDAD
M
VMSFVNL
VEYDKEFSPHQRHHKEFKFNLSQIPEGEAVTAAEFRVYKDCVVGSFKNQTFLISIYQVLQEH
Q
H
RDSDLFLLDTRVVWASEEGWLEFDITATSNLWVVTPQHNMGLQLSVVTRDGLHVNPRAAGLVGRDGPY
D
KQPFMVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVSRGSGSS
DYNGSELKTACKKHELYVSFQD
L
GWQ
DWIIAPKGYAANYCDGECSFPLNAHMNATNHAIVQTLVHLMNPEYVPKPCCAPTKLNAISVLYFDD
N
SNVILKKYRNMVVRACGCH




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser