NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS23514.1 (previous version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
23514.1 Public Mus musculus 9 Ip6k1 10 38.1 68 CCDS HistoryNCBI Gene:27399Re-query CCDS DB by CCDS ID:23514.1Re-query CCDS DB by GeneID:27399

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 23514.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000035214 ENSMUSP00000035214 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000035214Link to Ensembl Protein Viewer:ENSMUSP00000035214Re-query CCDS DB by Nucleotide ID:ENSMUST00000035214Re-query CCDS DB by Protein ID:ENSMUSP00000035214
Original member Current member EBI,WTSI OTTMUST00000110103 OTTMUSP00000061354 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000110103Link to Vega Protein Viewer:OTTMUSP00000061354Re-query CCDS DB by Nucleotide ID:OTTMUST00000110103Re-query CCDS DB by Protein ID:OTTMUSP00000061354
Original member Current member NCBI NM_013785.2 NP_038813.2 Accepted alive Link to Nucleotide Sequence:NM_013785.2Link to Protein Sequence:NP_038813.2Re-query CCDS DB by Nucleotide ID:NM_013785Re-query CCDS DB by Protein ID:NP_038813Link to BLink:NP_038813.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_038813.2 433 Q6PD10 433 100% 0 0

Chromosomal Locations for CCDS 23514.1

Assembly GRCm38 (GCF_000001635.20)

On '+' strand of Chromosome 9 (NC_000075.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 9Link to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9

Chromosome Start Stop Links
9 108024228 108024450 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 108031999 108032209 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 108040905 108041086 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 108044725 108044900 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 108045463 108045972 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1302 nt):
ATGTGTGTTTGTCAAACCATGGAAGTGGGGCAGTATGGCAAGAACGCAAGTCGGGCCGGAGACCGAGGAG
TC
CTCCTGGAGCCCTTCATCCATCAGGTGGGCGGGCACAGCAGCATGATGCGGTACGACGACCACACTGT
G
TGCAAACCTCTCATCTCCCGGGAACAGCGCTTCTACGAGTCACTCCCTCCCGAAATGAAGGAATTCACC
CCA
GAGTACAAAGGCGTGGTTTCTGTCTGTTTTGAGGGAGACAGTGATGGTTACATCAACTTGGTAGCCT
AT
CCTTATGTGGAGAGTGAAACTGTAGAGCAAGATGACACACCAGAGCGGGAGCAACCTCGGCGCAAACA
C
TCCCGCCGGAGCCTGCATCGGTCTGGCAGTGGTAGTGACCACAAGGAGGAGAAAGCCAGCCTGTCCTTT
GAG
ACCTCTGAGAGCTCCCAGGAGGCAAAGAGTCCAAAGGTGGAACTGCACAGCCACTCAGATGTCCCTT
TC
CAGATGCTAGACAGCAATAGCGGTCTGAGCTCCGAGAAGATCAGCTACAACCCCTGGAGCCTGCGCTG
C
CACAAGCAGCAGCTGAGCCGCATGCGCTCCGAGTCCAAGGACCGAAAACTCTACAAGTTCCTCCTGCTT
GAG
AACGTGGTACACCACTTCAAGTACCCCTGTGTGCTGGACTTGAAGATGGGTACCCGGCAGCATGGCG
AT
GATGCTTCAGCTGAAAAGGCTGCCCGGCAGATGAGGAAGTGTGAGCAGAGCACGTCGGCCACGCTGGG
G
GTCAGGGTCTGTGGCATGCAGGTGTACCAGCTGGACACAGGTCATTACCTCTGCAGGAATAAGTACTAT
GGC
CGTGGACTCTCCATCGAGGGCTTCCGCAATGCGCTCTATCAGTACCTGCACAATGGCTTGGACCTTC
GA
CGTGACCTTTTTGAGCCAATCCTGAGCAAACTGCGGGGCCTCAAAGCCGTACTGGAGCGGCAGGCCTC
C
TACCGCTTCTACTCCAGCTCCCTGCTTGTCATCTATGATGGCAAGGAGTGCCGGTCTGAGCTACGTCTC
AAG
CACGTGGACATGGGGCTCCCTGAGGTGCCACCACCCTGTGGCCCCAGCACCAGTCCTAGCAGCACCA
GT
CTTGAGGCTGGCCCCTCTTCTCCGCCCAAGGTGGATGTTCGCATGATTGACTTTGCACACAGCACATT
C
AAGGGCTTCCGGGATGACCCCACTGTTCACGATGGGCCAGACAGAGGCTATGTGTTTGGCTTGGAGAAT
CTT
ATCAGCATCATGGAGCAGATGCGGGATGAGAACCAGTAG


Translation (433 aa):
MCVCQTMEVGQYGKNASRAGDRGVLLEPFIHQVGGHSSMMRYDDHTVCKPLISREQRFYESLPPEMKEFT
P
EYK
GVVSVCFEGDSDGYINLVAYPYVESETVEQDDTPEREQPRRKHSRRSLHRSGSGSDHKEEKASLSF
E
TSE
SSQEAKSPKVELHSHSDVPFQMLDSNSGLSSEKISYNPWSLRCHKQQLSRMRSESKDRKLYKFLLL
E
NVVHHFKYPCVLDLKMGTRQHGDDASAEKAARQMRKCEQSTSATLGVRVCGMQ
VYQLDTGHYLCRNKYY
G
RGLSIEGFRNALYQYLHNGLDLRRDLFEPILSKLRGLKAVLERQASYRFYSSSLLVIYDGKECRSELRL
K
HVDMGLPEVPPPCGPSTSPSSTSLEAGPSSPPKVDVRMIDFAHSTFKGFRDDPTVHDGPDRGYVFGLEN
L
ISIMEQMRDENQ




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser