NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS39803.1 (previous version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
39803.1 Public Mus musculus 7 Bcam 10 38.1 68 CCDS HistoryNCBI Gene:57278Re-query CCDS DB by CCDS ID:39803.1Re-query CCDS DB by GeneID:57278

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Sequence IDs included in CCDS 39803.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000003061 ENSMUSP00000003061 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000003061Link to Ensembl Protein Viewer:ENSMUSP00000003061Re-query CCDS DB by Nucleotide ID:ENSMUST00000003061Re-query CCDS DB by Protein ID:ENSMUSP00000003061
Original member Current member EBI,WTSI OTTMUST00000078567 OTTMUSP00000041791 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000078567Link to Vega Protein Viewer:OTTMUSP00000041791Re-query CCDS DB by Nucleotide ID:OTTMUST00000078567Re-query CCDS DB by Protein ID:OTTMUSP00000041791
Original member Current member NCBI NM_020486.2 NP_065232.1 Accepted alive Link to Nucleotide Sequence:NM_020486.2Link to Protein Sequence:NP_065232.1Re-query CCDS DB by Nucleotide ID:NM_020486Re-query CCDS DB by Protein ID:NP_065232Link to BLAST:NP_065232.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_065232.1 622 Q9R069 622 100% 0 0

Chromosomal Locations for CCDS 39803.1

Assembly GRCm38 (GCF_000001635.20)

On '-' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 7Link to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

Chromosome Start Stop Links
7 19756614 19756619 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 19756708 19756825 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 19758424 19758568 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 19758659 19758803 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 19758960 19759096 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 19760047 19760188 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 19760294 19760412 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 19764040 19764196 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 19764653 19764789 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 19765334 19765516 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 19765613 19765709 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 19766689 19766759 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 19766836 19767061 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 19768452 19768573 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 19770407 19770470 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1869 nt):
ATGGAACCCCCTGACGCCCGCGCAGGGCTGCTGTGGCTCACCTTCCTGCTGTCGGGCTACTCAGGTGCCC
AG
GCTGAGCTGCACGTGTCCGTGCCCCCACGGGTGGAGGTGATGCGAGGCGAGCAAGTCGCCCTGGACTG
C
ACTCCACGGGAGCACCCTGAGCATTACGTGCTGGAATGGTTCCTCGTTGATGGTACTGGGGCTCGACAC
CGT
CTGGCTTCTGTGGAACCACAGGGCTCAGAGTTCCTGGGCACAGTCCACTCTCTGGGCCGCGTACCCC
CA
TACGAGGTAGACTCTCGTGGGCGCCTGGTGATAGCAAAGGTCCAGGTGGGCGATGGACGGGACTACGT
G
TGCGTAGTGAAGGCTGGGGCAGCGGGTACCTCAGAGGCCACCTCAAGTGTCCGTGTGTTTGCAACACCA
GAG
GATACGGAGGTGTCTCCCAACAAAGGGACGCTGTCTGTGATGGACCAGTTTGCCCAGGAGATTGCCA
CC
TGCAGCAGCAACAACGGAAACCCCGTGCCTCGGATCACATGGTACCGAAACGGGCAGCGTCTGGAAGT
A
CCCATGGAGGTGAACCAAAAGGGCTACATAACCATCCGTACTGTCCGGGAAGCCTCAGGCCTGTACTCC
CTG
ACCAGCACCCTCTACCTGAGGCTGCACAAGGATGATCGGGATGCCAACTTCCACTGTGCTGCTCACT
AC
GACTTGCCCTCAGGCCAACATGGCCGCCTGGACAGCCATACCTTTCGCCTCACCCTGCACTATCCCAC
G
GAACATGTAGAATTCTGGGTGGGGAGCCCGTCCACCACGGAGGGCTGGGTCCGTGAGGGTGATGCTGTC
CAG
CTGCTCTGCCAGGGCGATGGCAGCCCCAGCCCAGAGTATTCTTTTTTCCGCCAGCAGGGTACCCAGG
AG
GAACAGCTGAATGTCAACCTCAAGGGAAACTTGACCCTAGAACGGGTGCATCGGAACCAGAGCGGGAT
C
TACGGCTGCAGAGTGGAGGATTACGATGCCGACGAGGAAGTGCAACTTGTCAAGAAGCTAAAGCTGCAC
GTG
GCCTACCTGGATCCATTGGAGCTGAGCGTGCCTGAGGAGCTCTTCGTATTCCTGAACAGCAGCAGCA
CG
GTGGTGAACTGCTCCGCTAGAGGCCTGCCTACTCCTACTGTGCGATGGACCAAGGATTCTGTGACCCT
T
GCAGACGGCCCCATGCTCTCTCTCCAGTCTGTGACCTTTGACTCAGCTGGCACCTATACCTGTGAGGCG
TCC
ACACCCACAGTCCCCCTCCTGAGCCGCACACAGAGTTTCCAGCTCATCGTCCAAGGAGCACCAGAGT
TA
AAACCGAATGAGATAATGCCCAAATCAGGGAATAGCTGGACAGAAGGCGATGAAGTCATGCTGACCTG
C
TCCGCCCGGGGCTTCCCAGAGCCCAAACTCACCTGGAGTCAGCGAGGCGATACTCCAGCAGAGCCGCCC
TTT
GAGGGTAGAGGCTGGAAGAGCAGCTCGCTGATGGTGAAAGTGACCAGCGCCCTGAGCCGAGAGGGCG
TG
TCCTGTGAAGCGTCTAACATCCATGGCAAGAAAGGCCATGTCTTCCACTTTGGCTCTGTGGCCCCTCA
G
ACTGCCCAGGCTGGAGTGGCTGTCATGGCTGTAGCTGTCAGCGTCGGTCTTTTGCTACTCGTGGTCGCT
GCT
TTCTATTGCATGAGACGCAAAGGGCGCCCTGGCTGCTGCCGGCGAGCAGAGAAAGGGGCGCCGCCAG
CC
AGGGAACCGGAGTTGAGCCACTCTGGGTCAGAGCGGCCAGAACACACGGGCCTTCTCATGGGTGGGCC
C
TCCGGAGGAGGCAGAGGTGGCAGTGGAGGCTTTGGAGATGAGTGTTGA


Translation (622 aa):
MEPPDARAGLLWLTFLLSGYSGAQAELHVSVPPRVEVMRGEQVALDCTPREHPEHYVLEWFLVDGTGARH
R
LASVEPQGSEFLGTVHSLGRVPPYEVDSRGRLVIAKVQVGDGRDYVCVVKAGAAGTSEATSSVRVF
ATP
E
DTEVSPNKGTLSVMDQFAQE
IATCSSNNGNPVPRITWYRNGQRLEVPMEVNQKGYITIRTVREASGLYS
L
TSTLYLRLHKDDRDANFHCAAHYDLPSGQHGRLDSHTFRLTLH
YPTEHVEFWVGSPSTTEGWVREGDAV
Q
LLCQGDGSPSPEYSFFRQQ
GTQEEQLNVNLKGNLTLERVHRNQSGIYGCRVEDYDADEEVQLVKKLKLH
V
A
YLDPLELSVPEELFVFLNSSSTVVNCSARGLPTPTVRWTKDSVTLADGPMLSLQSVTFDSAGTYTCEA
S
TPTVPLLSRTQSFQLIVQ
GAPELKPNEIMPKSGNSWTEGDEVMLTCSARGFPEPKLTWSQRGDTPAEPP
F
EGRGWKSSSLMVKVTSALSREGVSCEASNIHGKKGHVFHFGS
VAPQTAQAGVAVMAVAVSVGLLLLVVA
A
FYCMRRKGRPGCCRRAEKGA
PPAREPELSHSGSERPEHTGLLMGGPSGGGRGGSGGFGDEC



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser