NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS51400.1 (previous version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
51400.1 Public Mus musculus 4 Prdm16 10 38.1 68 CCDS HistoryNCBI Gene:70673Re-query CCDS DB by CCDS ID:51400.1Re-query CCDS DB by GeneID:70673

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Sequence IDs included in CCDS 51400.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000105636 ENSMUSP00000101261 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000105636Link to Ensembl Protein Viewer:ENSMUSP00000101261Re-query CCDS DB by Nucleotide ID:ENSMUST00000105636Re-query CCDS DB by Protein ID:ENSMUSP00000101261
Original member Current member EBI,WTSI OTTMUST00000024682 OTTMUSP00000011334 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000024682Link to Vega Protein Viewer:OTTMUSP00000011334Re-query CCDS DB by Nucleotide ID:OTTMUST00000024682Re-query CCDS DB by Protein ID:OTTMUSP00000011334
Original member Current member NCBI NM_001177995.1 NP_001171466.1 Accepted alive Link to Nucleotide Sequence:NM_001177995.1Link to Protein Sequence:NP_001171466.1Re-query CCDS DB by Nucleotide ID:NM_001177995Re-query CCDS DB by Protein ID:NP_001171466Link to BLink:NP_001171466.1

Chromosomal Locations for CCDS 51400.1

Assembly GRCm38 (GCF_000001635.20)

On '-' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 4Link to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

Chromosome Start Stop Links
4 154320910 154320922 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 154323247 154323480 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 154328260 154328434 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 154328664 154328833 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 154334375 154334452 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 154335093 154335262 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 154337643 154337727 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 154340721 154342137 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 154345322 154345475 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 154345995 154346142 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 154347924 154348134 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 154355247 154355349 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 154367178 154367315 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 154476639 154476689 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 154528582 154528931 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 154636723 154636759 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3534 nt):
ATGCGATCCAAGGCGAGGGCGAGGAAGCTAGCCAAAAGTGACGGTGACGTTGTAAATAATATGTATGAAC
CT
GACCCGGACCTGCTGGCCGGCCAGAGTGCCGAGGAGGAGACCGAAGACGGCATCCTGTCCCCCATCCC
C
ATGGGGCCACCGTCCCCCTTCCCCACCAGCGAGGACTTCACTCCCAAGGAGGGCTCGCCCTATGAGGCT
CCT
GTCTACATTCCTGAAGACATTCCAATCCCACCAGACTTCGAGCTACGAGAGTCCTCCATACCAGGAG
CT
GGCCTGGGGATCTGGGCCAAGCGGAAGATGGAAATCGGGGAGAGGTTTGGCCCCTACGTGGTGACGCC
C
CGGGCCGCACTGAAGGAGGCCGACTTTGGATGGGAGCAGATGCTGACGGATACAGAGGTGTCATCCCAG
GAG
AGCTGCATCAAAAAGCAGATCTCTGAAGACTTGGGTAGCGAGAAGTTCTGCGTGGATGCCAATCAGG
CG
GGGTCTGGCAGCTGGCTCAAGTACATCCGTGTAGCGTGTTCCTGTGATGACCAAAACCTCGCCATGTG
T
CAGATCAACGAACAGATTTACTATAAAGTCATTAAGGACATCGAGCCTGGAGAGGAACTGTTGGTGCAT
GTG
AAAGAAGGTGCCTACTCCTTGGGTGTCATGGCCCCCAGCTTGGATGAGGACCCCACATTCCGCTGTG
AT
GAGTGTGATGAGCTCTTCCAGTGCAGGCTGGACCTGAGGCGCCACAAGAAGTACGCGTGCAGCTCTGC
A
GGAGCCCAGCTCTACGAGGGCCTAGGGGAGGAACTCAAGCCCGAGGGCCTTGGCGTGGGCAGCGACGGG
CAA
GCGCATGAGTGCAAGGATTGCGAGCGGATGTTCCCCAACAAGTACAGCTTGGAGCAACACATGATCG
TC
CACACGGAAGAGCGTGAGTACAAATGTGACCAGTGTCCCAAGGCCTTCAACTGGAAGTCCAACCTCAT
C
CGCCACCAGATGTCTCACGACAGTGGCAAGCGCTTCGAATGTGAAAACTGTGTCAAGGTGTTCACGGAC
CCC
AGCAACCTCCAGCGTCACATCCGCTCACAGCATGTCGGTGCCCGGGCCCATGCCTGCCCTGACTGTG
GC
AAGACCTTCGCCACATCCTCTGGCCTCAAACAGCACAAGCATATCCACAGCACGGTGAAGCCATTCAT
A
TGCGAGGTCTGCCACAAGTCCTACACGCAGTTCTCCAACCTGTGCCGGCACAAGCGGATGCACGCCGAC
TGC
AGGACGCAGATCAAGTGCAAGGACTGTGGGCAGATGTTCAGCACTACCTCCTCCCTCAACAAGCATC
GG
AGATTCTGCGAGGGCAAGAACCATTACACGCCTGGCAGCATCTTCACCCCAGGCCTGCCCTTGACCCC
C
AGCCCCATGATGGACAAGACAAAACCCTCCCCGACCCTCAACCACGGGGGCCTAGGCTTCAGCGAGTAC
TTC
CCCTCCAGACCTCATCCTGGGAGCCTGCCCTTCTCGGCTGCTCCTCCGGCCTTCCCCGCACTCACTC
CG
GGCTTCCCGGGCATCTTTCCTCCATCCCTGTACCCACGACCACCTCTGCTACCTCCCACGCCGCTGCT
C
AAGAGCCCCCTGAACCACGCGCAGGACGCCAAGCTACCCAGCCCGCTGGGAAACCCAGCCCTGCCCCTT
GTC
TCCGCGGTCAGCAATAGCAGCCAGGGTGCCACAGCGGCCACCGGGTCAGAGGAGAAATTTGATGGCC
GC
TTGGAAGACGCATATGCGGAGAAGGTCAAAAATAGGAGCCCTGACATGTCGGATGGCAGTGACTTTGA
G
GATATCAACACCACGACCGGGACAGACTTGGACACTACCACGGGCACGGGGTCAGACCTGGACAGCGAC
CTG
GACAGTGACAGAGACAAAGGCAAGGACAAGGGGAAGCCAGTGGAGAGCAAACCTGAGTTTGGGGGTG
CA
TCTGTGCCCCCTGGGGCCATGAACAGTGTGGCCGAGGTACCGGCCTTCTACTCACAGCATTCCTTCTT
C
CCGCCACCCGAGGAACAGCTGCTGACGGCCTCGGGAGCTGCCGGCGACTCCATCAAGGCCATCGCGTCC
ATC
GCGGAGAAATACTTCGGTCCTGGCTTCATGAGCATGCAGGAGAAGAAGCTGGGCTCACTACCCTACC
AC
TCCGTGTTCCCCTTCCAGTTCCTGCCTAACTTTCCCCACTCCCTCTACCCCTTTACGGACCGAGCCCT
C
GCCCACAACTTGCTGGTCAAGGCTGAGCCAAAGTCACCCCGGGATGCCCTCAAGGTGGGCGGCCCCAGT
GCG
GAGTGCCCCTTCGACCTCACCACCAAACCAAAAGAGGCCAAACCCGCCCTGCTCGCACCCAAGGTCC
CC
CTCATCCCCTCATCTGGCGAGGAACAGCCACTGGACCTGAGCATCGGCAGCAGGGCCAGGGCAAGCCA
G
AACGGAGGTGGCCGTGAGCCGCGGAAGAACCACGTCTACGGTGAACGGAAGCCGGGGGTCAGCGAGGGG
CTG
CCTAAGGTGTGCCCAGCACAGCTGCCCCAGCAGCCCTCCTTGCATTATGCTAAGCCTTCACCGTTCT
TC
ATGGATCCCATCTACAGGGTAGAAAAGCGGAAGGTGGCAGACCCTGTGGGAGTCCTGAAAGAGAAGTA
C
CTGCGGCCGTCCCCACTTCTGTTCCACCCCCAGATGTCAGCCATAGAAACCATGACGGAGAAGCTGGAG
AGC
TTTGCAGCCATGAAGGCCGACTCAGGCAGCTCCCTGCAGCCCCTGCCTCACCACCCGTTCAACTTCC
GC
TCCCCACCCCCAACGCTCTCGGATCCCATCCTCAGGAAGGGGAAGGAGAGATACACGTGCAGGTACTG
T
GGCAAGATCTTCCCCAGATCTGCAAATCTCACAAGACATCTGAGGACACACACAGGGGAGCAGCCATAC
AG
G
TGCAAGTACTGTGACCGGTCATTCAGCATCTCCTCCAACCTCCAGCGGCACGTGAGGAACATCCACA
AC
AAAGAGAAGCCGTTCAAGTGCCATCTGTGCAACCGCTGCTTCGGGCAGCAGACCAACCTAGACCGGCA
C
CTGAAGAAGCACGAACACGAGGGCGCACCAGTGAGCCAGCACTCCGGGGTGCTCACGAACCACCTGGGC
ACC
AGCGCCTCCTCCCCCACCTCCGAGTCGGACAACCATGCACTTTTAGATGAGAAGGAAGATTCTTACT
TC
TCCGAGATCCGAAACTTCATCGCCAACAGCGAGATGAACCAGGCATCCACTCGAATGGACAAACGGCC
T
GAGATCCAAGACCTGGACAGCAACCCACCGTGTCCAGGCTCAGCCAGTGCAAAGCCAGAGGACGTAGAG
GAG
GAGGAAGAGGAGGAGCTGGAGGAAGAGGATGATGACAGCTTAGCCGGGAAGTCACAGGAGGACACGG
TG
TCCCCCACACCTGAGCCCCAAGGAGTCTATGAAGATGAAGAGGATGAGGAACCACCCAGCCTGACCAT
G
GGCTTTGACCATACCCGGAGGCATATGCAATGA


Translation (1177 aa):
MRSKARARKLAKSDGDVVNNMYEPDPDLLAGQSAEEETEDGILSPIPMGPPSPFPTSEDFTPKEGSPYEA
P
VYIPEDIPIPPDFELRESSIPGAGLGIWAKRKMEIGERFGPYVVTPRAALKEADFGWE
QMLTDTEVSSQ
E
SCIKK
QISEDLGSEKFCVDANQAGSGSWLKYIRVACSCDDQNLAMCQINEQIYYKVIKDIEPGEELLVH
V
KEGAYSLGVMAPSLD
EDPTFRCDECDELFQCRLDLRRHKKYACSSAGAQLYEGLGEELKPEGLGVGSDG
Q
AHECKDCERMFPNKY
SLEQHMIVHTEEREYKCDQCPKAFNWKSNLIRHQMSHDSGKRFECENCVKVFTD
P
SNLQRHIRSQHVGARAHACPDCGKTFATSSGLKQHKHIHSTVKPFI
CEVCHKSYTQFSNLCRHKRMHAD
C
RTQIKCKDCGQMFSTTSSLNKHRRFCEGKNHYTPGSIFTPGLPLTPSPMMDKTKPSPTLNHGGLGFSEY
F
PSRPHPGSLPFSAAPPAFPALTPGFPGIFPPSLYPRPPLLPPTPLLKSPLNHAQDAKLPSPLGNPALPL
V
SAVSNSSQGATAATGSEEKFDGRLEDAYAEKVKNRSPDMSDGSDFEDINTTTGTDLDTTTGTGSDLDSD
L
DSDRDKGKDKGKPVESKPEFGGASVPPGAMNSVAEVPAFYSQHSFFPPPEEQLLTASGAAGDSIKAIAS
I
AEKYFGPGFMSMQEKKLGSLPYHSVFPFQFLPNFPHSLYPFTDRALAHNLLVKAEPKSPRDALKVGGPS
A
ECPFDLTTKPKEAKPALLAPKVPLIPSSGEEQPLDLSIGSRARASQNGGGREPRKNHVYGERKPGVSEG
L
PKVCPAQLPQQPSLHYAKPSPFFMDPIY
RVEKRKVADPVGVLKEKYLRPSPLLFHPQMSAIETMTEKLE
S
FAAMKADSGSSLQPLPHHPFNFRSPPPTLSDPILRKGKERYTC
RYCGKIFPRSANLTRHLRTHTGEQPY
R
CKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCNRCFGQQTNLDRHLKKHEHEGAPVSQHSGVLTNHLG
T
SASSPTSESDNHALLDEKEDSYFSEIRNFIANSEMNQASTRMDK
RPEIQDLDSNPPCPGSASAKPEDVE
E
EEEEELEEEDDDSLAGKSQEDTVSPTPEPQGVYEDEEDEEPPSLTMGFDHTR
RHMQ



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser