NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS50962.1 (previous version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
50962.1 Public Mus musculus 3 Shc1 10 38.1 68 CCDS HistoryNCBI Gene:20416Re-query CCDS DB by CCDS ID:50962.1Re-query CCDS DB by GeneID:20416

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Sequence IDs included in CCDS 50962.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000094378 ENSMUSP00000091940 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000094378Link to Ensembl Protein Viewer:ENSMUSP00000091940Re-query CCDS DB by Nucleotide ID:ENSMUST00000094378Re-query CCDS DB by Protein ID:ENSMUSP00000091940
Original member Current member EBI,WTSI OTTMUST00000052404 OTTMUSP00000024848 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000052404Link to Vega Protein Viewer:OTTMUSP00000024848Re-query CCDS DB by Nucleotide ID:OTTMUST00000052404Re-query CCDS DB by Protein ID:OTTMUSP00000024848
Original member Current member NCBI NM_001113331.2 NP_001106802.1 Accepted alive Link to Nucleotide Sequence:NM_001113331.2Link to Protein Sequence:NP_001106802.1Re-query CCDS DB by Nucleotide ID:NM_001113331Re-query CCDS DB by Protein ID:NP_001106802Link to BLAST:NP_001106802.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001106802.1 579 P98083-1 579 100% 0 0

Chromosomal Locations for CCDS 50962.1

Assembly GRCm38 (GCF_000001635.20)

On '+' strand of Chromosome 3 (NC_000069.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3

Chromosome Start Stop Links
3 89421851 89422345 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 89422926 89422996 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 89423508 89423571 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 89423697 89423816 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 89424190 89424243 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 89424555 89424606 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 89424766 89424892 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 89426515 89426701 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 89426788 89426857 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 89426939 89427070 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 89427208 89427446 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 89428317 89428445 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1740 nt):
ATGGATCTTCTACCCCCCAAGCCGAAGTACAACCCACTTCGGAATGAGTCTCTGTCATCGCTGGAGGAGG
GG
GCTTCGGGGTCTACCCCTCCGGAGGAGCTACCTTCCCCATCAGCTTCATCCCTGGGACCCATTCTGCC
T
CCTCTGCCGGGGGACGATAGTCCGACTACCCTGTGTTCCTTCTTTCCCCGGATGAGCAACCTGAAGCTG
GCC
AATCCTGCTGGGGGGCGCCTGGGGCCTAAAGGGGAGCCAGGAAAGGCTGCTGAAGATGGGGAAGGGA
GT
GCAGGGGCAGCCCTTCGGGACTCAGGCCTCTTGCCCCTCCTCCAGGACATGAACAAGCTGAGTGGAGG
C
GGCGGGCGCAGGACTCGGGTAGAAGGGGGCCAGCTGGGGGGCGAGGAGTGGACCAGACACGGGAGCTTT
GTC
AATAAGCCCACACGAGGCTGGCTGCATCCCAACGACAAAGTCATGGGACCTGGGGTTTCCTACTTGG
TT
CGGTACATGGGCTGTGTGGAGGTCTTACAGTCAATGCGAGCCCTTGACTTCAATACCCGGACTCAGGT
C
ACCAGGGAGGCCATCAGTTTGGTGTGTGAAGCTGTGCCTGGTGCCAAAGGGGCGACAAGGAGGAGAAAG
CCT
TGTAGCCGCCCACTCAGCTCCATCCTGGGGAGGAGTAACCTGAAGTTTGCTGGAATGCCAATCACTC
TC
ACTGTGTCTACCAGCAGCCTTAACCTCATGGCAGCCGACTGCAAACAGATCATTGCCAACCATCACAT
G
CAATCTATCTCTTTCGCGTCCGGTGGGGATCCGGACACAGCTGAGTATGTTGCCTATGTTGCCAAAGAC
CCT
GTGAATCAGAGAGCCTGCCATATCCTGGAGTGTCCTGAAGGGCTTGCTCAGGATGTCATCAGCACCA
TC
GGGCAGGCCTTTGAGTTGCGCTTCAAACAGTATCTCAGGAATCCACCGAAGCTGGTCACCCCCCATGA
C
AGGATGGCTGGCTTTGATGGCTCAGCTTGGGATGAGGAGGAAGAAGAGCCCCCTGACCATCAGTACTAC
AAT
GACTTTCCAGGGAAGGAACCCCCTCTTGGTGGGGTGGTAGATATGAGGCTTCGGGAAGGGGCTGCTC
GA
CCCACTCTGCCTAGTGCCCAGATGTCCAGCCACTTGGGAGCTACACTGCCTATAGGGCAGCATGCTGC
A
GGAGACCATGAAGTCCGTAAACAGATGTTGCCTCCGCCGCCTTGCCCAGGCAGAGAACTCTTCGATGAC
CCC
TCCTATGTCAACATCCAGAATCTAGACAAGGCCCGGCAGGCTGGGGGTGGGGCTGGGCCCCCAAATC
CT
TCTCTTAATGGCAGTGCACCCCGAGACCTTTTTGACATGAAGCCCTTTGAAGATGCACTTCGGGTGCC
A
CCCCCACCGCAGTCCATGTCCATGGCTGAGCAGCTGCAAGGGGAGCCCTGGTTCCACGGGAAGCTGAGC
CGG
AGGGAGGCCGAGGCGCTGCTGCAGCTCAATGGTGACTTCTTGGTGCGAGAGAGCACGACCACGCCTG
GC
CAGTATGTGCTCACTGGCCTGCAGAGTGGGCAGCCCAAGCACTTGCTGCTGGTGGACCCTGAAGGTGT
G
GTTCGGACAAAGGATCACCGCTTTGAGAGTGTCAGTCACCTGATCAGCTACCACATGGACAATCACTTG
CCC
ATCATCTCTGCGGGCAGCGAACTGTGCCTACAGCAACCCGTGGATCGGAAAGTGTGA


Translation (579 aa):
MDLLPPKPKYNPLRNESLSSLEEGASGSTPPEELPSPSASSLGPILPPLPGDDSPTTLCSFFPRMSNLKL
A
NPAGGRLGPKGEPGKAAEDGEGSAGAALRDSGLLPLLQDMNKLSGGGGRRTRVEGGQLGGEEWTRHGSF
V
NKPTRGWLHPNDKVMGPGVSYLVR
YMGCVEVLQSMRALDFNTRTQVTREAISLVCEAVPGAKGATRRRK
P
CSRPLSSILGRSNLKFAGMPITLTVSTSSLNLMAADCKQ
IIANHHMQSISFASGGDPDTAEYVAYVAKD
P
VNQR
ACHILECPEGLAQDVISTIGQAFELRFKQYLRNPPKLVTPHDRMAGFDGSAWDEEEEEPPDHQYY
N
DFPGKEPPLGGVVDMRLREGAARPTLPSAQMSSHLGATL
PIGQHAAGDHEVRKQMLPPPPCPGRELFDD
P
SYVNIQNLDKARQAGGGAGPPNPSLNGSAPRDLFDM
KPFEDALRVPPPPQSMSMAEQLQGEPWFHGKLS
R
REAEALLQLNGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDPEGV
VRTKDHRFESVSHLISYHMDNHL
P
IISAGSELCLQQPVDRKV




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser