NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS50358.1 (previous version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
50358.1 Public Mus musculus 19 Efemp2 10 38.1 68 CCDS HistoryNCBI Gene:58859Re-query CCDS DB by CCDS ID:50358.1Re-query CCDS DB by GeneID:58859

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Sequence IDs included in CCDS 50358.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000070118 ENSMUSP00000064719 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000070118Link to Ensembl Protein Viewer:ENSMUSP00000064719Re-query CCDS DB by Nucleotide ID:ENSMUST00000070118Re-query CCDS DB by Protein ID:ENSMUSP00000064719
Original member Current member EBI,WTSI OTTMUST00000094317 OTTMUSP00000052424 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000094317Link to Vega Protein Viewer:OTTMUSP00000052424Re-query CCDS DB by Nucleotide ID:OTTMUST00000094317Re-query CCDS DB by Protein ID:OTTMUSP00000052424
Original member Current member NCBI NM_001164352.1 NP_001157824.1 Accepted alive Link to Nucleotide Sequence:NM_001164352.1Link to Protein Sequence:NP_001157824.1Re-query CCDS DB by Nucleotide ID:NM_001164352Re-query CCDS DB by Protein ID:NP_001157824Link to BLAST:NP_001157824.1

Chromosomal Locations for CCDS 50358.1

Assembly GRCm38 (GCF_000001635.20)

On '+' strand of Chromosome 19 (NC_000085.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19

Chromosome Start Stop Links
19 5475011 5475178 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 5475408 5475456 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 5476066 5476272 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 5477562 5477684 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 5477927 5478043 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 5478201 5478320 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 5480030 5480149 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 5480234 5480360 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 5480546 5480741 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 5481561 5481722 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1389 nt):
ATGGGGGGTGCTGTGGCAGAAACCCCTGACTTCTGCCCACCACCTCCCAGCCTCAGGATGCTCCCTTTTG
CC
TCCTGCCTCCCCGGGTCTTTGCTGCTCTGGGCGTTTCTGCTGTTGCTCTTGGGAGCAGCGTCCCCACA
G
GATCCCGAGGAGCCGGACAGCTACACGGAATGCACAGATGGCTATGAGTGGGATGCAGACAGCCAGCAC
TGC
CGGGATGTCAACGAGTGCCTGACCATCCCGGAGGCTTGCAAGGGTGAGATGAAATGCATCAACCACT
AC
GGGGGTTATTTGTGTCTGCCTCGCTCTGCTGCCGTCATCAGTGATCTCCATGGTGAAGGACCTCCACC
G
CCAGCGGCCCATGCTCAACAACCAAACCCTTGCCCGCAGGGCTACGAGCCTGATGAACAGGAGAGCTGT
GTG
GATGTGGACGAGTGTACCCAGGCTTTGCATGACTGTCGCCCTAGTCAGGACTGCCATAACCTTCCTG
GC
TCCTACCAGTGCACCTGCCCTGATGGTTACCGAAAAATTGGACCCGAATGTGTGGACATAGATGAGTG
T
CGTTACCGCTATTGCCAGCATCGATGTGTGAACCTGCCGGGCTCTTTTCGATGCCAGTGTGAGCCAGGC
TTC
CAGTTGGGACCTAACAACCGCTCTTGTGTGGATGTGAATGAGTGTGACATGGGAGCCCCATGTGAGC
AG
CGCTGCTTCAACTCCTATGGGACCTTCCTGTGTCGCTGTAACCAGGGCTATGAGCTGCACCGGGATGG
C
TTCTCCTGCAGCGATATCGATGAGTGCGGCTACTCCAGTTACCTCTGCCAGTACCGCTGTGTCAACGAG
CCA
GGCCGATTCTCCTGTCACTGCCCACAAGGCTACCAGCTGCTGGCTACAAGGCTCTGCCAAGATATTG
AC
GAGTGTGAAACAGGTGCACACCAATGTTCTGAGGCCCAAACCTGTGTCAACTTCCATGGGGGTTACCG
C
TGTGTGGACACCAACCGTTGTGTGGAGCCCTATGTCCAAGTGTCAGACAACCGCTGCCTCTGCCCTGCC
TCC
AATCCCCTTTGTCGAGAGCAGCCTTCATCCATTGTGCACCGCTACATGAGCATCACCTCAGAGCGAA
GT
GTGCCTGCTGACGTGTTTCAGATCCAGGCAACCTCTGTCTACCCTGGTGCCTACAATGCCTTTCAGAT
C
CGTTCTGGAAACACACAGGGGGACTTCTACATTAGGCAAATCAACAATGTCAGCGCCATGCTGGTCCTC
GCC
AGGCCAGTGACGGGACCCCGGGAGTACGTGCTGGACCTGGAGATGGTCACCATGAATTCCCTTATGA
GC
TACCGGGCCAGCTCTGTACTGAGACTCACGGTCTTTGTGGGAGCCTATACCTTCTGA


Translation (462 aa):
MGGAVAETPDFCPPPPSLRMLPFASCLPGSLLLWAFLLLLLGAASPQDPEEPDSYTECTDGYEWDADSQH
C
R
DVNECLTIPEACKGEMKCINHYGGYLCLPRSAAVISDLHGEGPPPPAAHAQQPNPCPQGYEPDEQESC
V
DVDECTQALHDCRPSQDCHNLPGSYQCTCPDGYRKIGPECVDIDECRYRYCQHRCVNLPGSFRCQCEPG
F
QLGPNNRSCV
DVNECDMGAPCEQRCFNSYGTFLCRCNQGYELHRDGFSCSDIDECGYSSYLCQYRCVNE
P
GRFSCHCPQGYQLLATRLCQ
DIDECETGAHQCSEAQTCVNFHGGYRCVDTNRCVEPYVQVSDNRCLCPA
S
NPLCREQPSSIVHRYMSITSERSVPADVFQIQATSVYPGAYNAFQIRSGNTQGDFYIR
QINNVSAMLVL
A
RPVTGPREYVLDLEMVTMNSLMSYRASSVLRLTVFVGAYTF




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser