NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS26756.1 (previous version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
26756.1 Public Mus musculus 13 Htr1a 10 38.1 68 CCDS HistoryNCBI Gene:15550Re-query CCDS DB by CCDS ID:26756.1Re-query CCDS DB by GeneID:15550

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 26756.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000022235 ENSMUSP00000022235 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000022235Link to Ensembl Protein Viewer:ENSMUSP00000022235Re-query CCDS DB by Nucleotide ID:ENSMUST00000022235Re-query CCDS DB by Protein ID:ENSMUSP00000022235
Original member Current member NCBI NM_008308.4 NP_032334.2 Accepted alive Link to Nucleotide Sequence:NM_008308.4Link to Protein Sequence:NP_032334.2Re-query CCDS DB by Nucleotide ID:NM_008308Re-query CCDS DB by Protein ID:NP_032334Link to BLAST:NP_032334.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_032334.2 421 Q64264 421 100% 0 0

Chromosomal Locations for CCDS 26756.1

Assembly GRCm38 (GCF_000001635.20)

On '+' strand of Chromosome 13 (NC_000079.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13

Chromosome Start Stop Links
13 105444254 105445519 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1266 nt):
ATGGATATGTTCAGTCTTGGCCAGGGCAACAACACCACAACGTCCCTGGAGCCCTTCGGGACAGGCGGCA
AC
GATACTGGCCTCTCCAACGTGACCTTCAGCTACCAAGTGATCACCTCTCTTTTGCTGGGGACGCTCAT
T
TTCTGCGCGGTGCTCGGCAATGCCTGCGTGGTTGCTGCCATCGCCCTGGAGCGCTCCCTTCAGAATGTT
GCC
AACTATCTCATCGGCTCCTTGGCGGTCACCGATCTCATGGTGTCAGTGCTGGTGCTGCCCATGGCTG
CT
CTGTACCAGGTGCTCAACAAGTGGACTCTGGGTCAGGTCACCTGTGACCTGTTTATCGCCCTGGATGT
G
CTGTGCTGCACTTCGTCCATCCTGCACCTGTGCGCCATCGCGCTAGACAGGTACTGGGCAATCACCGAC
CCT
ATAGACTACGTGAACAAGAGGACGCCCCGGCGCGCCGCTGCGCTGATCTCGCTCACTTGGCTCATTG
GC
TTTCTCATCTCCATCCCGCCTATGCTGGGCTGGCGCACCCCGGAAGACCGCTCGAACCCCAACGAGTG
C
ACCATCAGCAAGGACCACGGGTACACCATCTACTCCACTTTCGGCGCTTTCTATATTCCGCTGCTGCTC
ATG
CTGGTCCTCTATGGGCGCATCTTCAGAGCCGCGCGCTTCCGAATCCGCAAGACGGTCAAGAAGGTGG
AA
AAGAAGGGAGCGGGCACCAGCTTCGGAACATCGTCGGCCCCGCCCCCCAAGAAGAGCCTGAATGGTCA
G
CCAGGTAGTGGGGACTGCAGGCGCAGTGCTGAGAACAGGGCGGTGGGGACTCCGTGCGCTAATGGGGCG
GTG
AGACAGGGTGAGGACGACGCCACCCTGGAGGTGATCGAGGTGCATCGAGTGGGCAACTCCAAAGGGC
AC
CTTCCTCTGCCCAGCGAATCAGGAGCTACCTCCTATGTCCCCGCCTGCTTGGAGAGAAAAAATGAGCG
C
ACTGCTGAGGCAAAGCGCAAGATGGCCTTGGCCCGTGAGAGGAAGACAGTGAAGACACTGGGCATCATC
ATG
GGCACCTTCATCCTCTGCTGGCTGCCCTTTTTCATTGTGGCCCTGGTCCTACCTTTCTGTGAGAGCA
GT
TGCCACATGCCTGAGTTGTTGGGTGCCATAATTAACTGGCTAGGCTACTCCAACTCCCTGCTCAACCC
A
GTTATTTATGCTTATTTCAACAAAGACTTTCAAAACGCTTTTAAGAAGATCATCAAGTGCAAGTTCTGC
CGC
TGA


Translation (421 aa):
MDMFSLGQGNNTTTSLEPFGTGGNDTGLSNVTFSYQVITSLLLGTLIFCAVLGNACVVAAIALERSLQNV
A
NYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITD
P
IDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPEDRSNPNECTISKDHGYTIYSTFGAFYIPLLL
M
LVLYGRIFRAARFRIRKTVKKVEKKGAGTSFGTSSAPPPKKSLNGQPGSGDCRRSAENRAVGTPCANGA
V
RQGEDDATLEVIEVHRVGNSKGHLPLPSESGATSYVPACLERKNERTAEAKRKMALARERKTVKTLGII
M
GTFILCWLPFFIVALVLPFCESSCHMPELLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC
R




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser