NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS24535.1 (previous version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
24535.1 Public Mus musculus 11 Gabrp 10 38.1 68 CCDS HistoryNCBI Gene:216643Re-query CCDS DB by CCDS ID:24535.1Re-query CCDS DB by GeneID:216643

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 24535.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000020366 ENSMUSP00000020366 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000020366Link to Ensembl Protein Viewer:ENSMUSP00000020366Re-query CCDS DB by Nucleotide ID:ENSMUST00000020366Re-query CCDS DB by Protein ID:ENSMUSP00000020366
Original member Current member EBI,WTSI OTTMUST00000014419 OTTMUSP00000006688 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000014419Link to Vega Protein Viewer:OTTMUSP00000006688Re-query CCDS DB by Nucleotide ID:OTTMUST00000014419Re-query CCDS DB by Protein ID:OTTMUSP00000006688
Original member Current member NCBI NM_146017.3 NP_666129.1 Accepted alive Link to Nucleotide Sequence:NM_146017.3Link to Protein Sequence:NP_666129.1Re-query CCDS DB by Nucleotide ID:NM_146017Re-query CCDS DB by Protein ID:NP_666129Link to BLink:NP_666129.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_666129.1 440 Q8QZW7 440 100% 0 0

Chromosomal Locations for CCDS 24535.1

Assembly GRCm38 (GCF_000001635.20)

On '-' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 11Link to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

Chromosome Start Stop Links
11 33552540 33552842 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 33554294 33554481 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 33554968 33555120 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 33556930 33557067 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 33563866 33563948 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 33567213 33567430 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 33568067 33568134 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 33572373 33572491 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 33573318 33573370 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1323 nt):
ATGAGCTACAGCCTCTATTTGGCCTTCCTGTGTCTGAGTCTCCTCACTCAGAGGACGTGCATCCAGGGGA
AC
CAGGTCAATGTGGAGGTCAGCAGAAGTGACAAGCTTTCCTTACCTGGCTTTGAGAACCTCACTGCAGG
A
TATAACAAATTCCTCAGGCCCAATTTCGGTGGTGACCCAGTTCGGATAGCACTGACTCTGGACATCGCC
AGC
ATCTCTAGCATCTCAGAGAGTAACATGGACTACACAGCCACTATATACCTCCGGCAGCGTTGGACAG
AC
CCACGGCTAGTGTTCGAAGGCAACAAGAGCTTTACTCTAGATGCCCGCCTTGTGGAGTTCCTCTGGGT
G
CCAGACACTTACATTGTAGAGTCCAAGAAGTCCTTCCTCCATGAAGTCACAGTGGGAAACAGGCTCATC
CGC
CTCTTCTCCAACGGCACAGTCCTGTACGCACTTAGAATCACAACAACAGTTACATGTAACATGGATC
TG
TCTAAATACCCCATGGACACACAGACCTGCAAGCTGCAGCTAGAAAGTTGGGGATACGATGGCAATGA
T
GTGGAGTTCTCCTGGCTGAGAGGGAATGACTCGGTGCGTGGACTTGAAAACCTGCGCCTTGCTCAGTAC
ACA
ATCCAACAGTATTTCACCCTGGTCACCGTATCCCAGCAGGAGACAGGAAACTATACGAGATTGGTTT
TG
CAATTTGAGCTTCGGAGGAACGTCCTGTATTTCATTCTGGAAACCTATGTCCCTTCCACCTTCCTGGT
G
GTGTTATCCTGGGTCTCCTTTTGGATCTCCCTCGATTCAGTTCCTGCGAGAACCTGCATTGGAGTGACA
ACG
GTGTTATCCATGACAACGCTGATGATCGGCTCCCGCACATCCCTACCCAACACCAACTGCTTCATAA
AG
GCCATCGATGTGTACCTAGGCATCTGCTTCAGCTTCGTGTTTGGGGCCTTACTGGAGTATGCAGTTGC
T
CACTACAGCTCCTTACAGCAGATGGCAGTCAAAGATAGGGGGCCAGCGAAGGACTCGGAAGAAGTCAAT
ATC
ACCAACATCATCAACAGCTCCATCTCCAGCTTTAAACGGAAGATTAGCTTTGCCAGCATTGAAATCT
CT
GGTGACAATGTCAACTATAGTGACTTGACAATGAAAGCCAGCGACAAGTTTAAGTTTGTCTTCCGAGA
G
AAGATCAGCAGAATCATTGATTATTTCACAATTCAAAACCCCAGCAATGTGGATCGATACTCCAAACTA
CTA
TTTCCTTTGATTTTTATGTTGGCCAATGTATTTTACTGGGCATACTACATGTATTTTTGA


Translation (440 aa):
MSYSLYLAFLCLSLLTQRTCIQGNQVNVEVSRSDKLSLPGFENLTAGYNKFLRPNFGGDPVRIALTLDIA
S
ISSISESNM
DYTATIYLRQRWTDPRLVFEGNKSFTLDARLVEFLWVPDTYIVESKKSFLHEVTVGNRLI
R
LFSNGTVLYAL
RITTTVTCNMDLSKYPMDTQTCKLQLESWGYDGNDVEFSWLRGNDSVRGLENLRLAQY
T
IQQYFTLVTVSQQET
GNYTRLVLQFELRRNVLYFILETYVPSTFLVVLSWVSFWISLDSVPARTCIGVT
T
VLSMTTLMIGSRTSLPNTNCFIKAIDVYLGICFSFVFGALLEYAVAHYSSLQQMAVKDR
GPAKDSEEVN
I
TNIINSSISSFKRKISFASIEISGDNVNYSDLTMKASDKFKFVFREKISRIIDYFTIQNPSNVDRYSKL
L
FPLIFMLANVFYWAYYMYF




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser