NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS15239.1 (previous version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
15239.1 Public Mus musculus 1 Htr5b 10 38.1 68 CCDS HistoryNCBI Gene:15564Re-query CCDS DB by CCDS ID:15239.1Re-query CCDS DB by GeneID:15564

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 15239.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000055884 ENSMUSP00000057212 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000055884Link to Ensembl Protein Viewer:ENSMUSP00000057212Re-query CCDS DB by Nucleotide ID:ENSMUST00000055884Re-query CCDS DB by Protein ID:ENSMUSP00000057212
Original member Current member EBI,WTSI OTTMUST00000049715 OTTMUSP00000023087 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000049715Link to Vega Protein Viewer:OTTMUSP00000023087Re-query CCDS DB by Nucleotide ID:OTTMUST00000049715Re-query CCDS DB by Protein ID:OTTMUSP00000023087
Original member Current member NCBI NM_010483.3 NP_034613.2 Accepted alive Link to Nucleotide Sequence:NM_010483.3Link to Protein Sequence:NP_034613.2Re-query CCDS DB by Nucleotide ID:NM_010483Re-query CCDS DB by Protein ID:NP_034613Link to BLAST:NP_034613.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_034613.2 370 P31387 370 99.1892% 0 3

Chromosomal Locations for CCDS 15239.1

Assembly GRCm38 (GCF_000001635.20)

On '-' strand of Chromosome 1 (NC_000067.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

Chromosome Start Stop Links
1 121510388 121510723 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 121527413 121528189 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1113 nt):
ATGGAAGTTTCTAACCTCTCAGGCGCCACTCCCGGCCTTGCCTTTCCTCCGGGACCCGAGAGCTGCAGTG
AC
AGCCCAAGTTCCGGCAGGAGCATGGGATCCACCCCAGGTGGGCTCATCTTGCCTGGCCGCGAGCCGCC
C
TTCTCTGCTTTCACCGTGCTTGTGGTGACTCTACTGGTGTTGCTGATCGTTGCCACTTTCTTATGGAAT
CTG
CTAGTTCTGGTGACTATCCTGCGTGTCCGCGCCTTCCACCGCGTGCCACATAACTTGGTGGCCTCGA
CA
GCCGTCTCGGATGTCCTGGTGGCGGCTCTGGTGATGCCTCTGAGCCTGGTGAGCGAGTTGTCCGTTGG
G
CGACGTTGGCAGCTAGGCAGGAGTCTGTGCCACGTGTGGATCTCCTTCGACGTGTTGTGCTGCACCGCC
AGC
ATCTGGAACGTGGCGGCCATCGCCCTGGATCGCTACTGGACTATCACGCGCCACCTGCAGTACACGC
TG
CGCACCCGGAGCCGTGCTTCTGCGCTCATGATCGCGATCACCTGGGCACTGTCCGCGCTCATTGCTCT
C
GCCCCGCTGCTTTTTGGCTGGGGCGAAGCCTATGATGCTCGGCTGCAGCGTTGCCAGGTGAGCCAGGAG
CCC
TCCTATGCTGTCTTCTCCACCTGCGGAGCCTTCTACCTGCCTCTGGCGGTGGTGCTCTTCGTCTACT
GG
AAAATATACAAAGCCGCCAAATTTCGATTCGGCCGCAGACGGCGGGCGGTGGTACCGCTTCCTGCCAC
C
ACGCAGGCAAAGGAAGCACCTCCAGAGTCTGAGATGGTGTTCACAGCCCGTCGCCGAGCAACAGTAACC
TTC
CAGACAAGCGGAGACTCGTGGCGGGAGCAGAAGGAGAAGCGGGCAGCCATGATGGTCGGGATCTTGA
TT
GGCGTGTTTGTGCTTTGTTGGATCCCCTTCTTCCTGACGGAGCTCATCAGCCCGCTCTGTGCCTGCAG
C
CTGCCACCCATCTGGAAAAGCATATTCCTGTGGCTTGGATATTCCAATTCGTTCTTCAACCCCTTGATT
TAC
ACTGCCTTTAATAAGAATTACAACAATGCCTTCAAGAGCCTCTTTACTAAGCAGAGATAA


Translation (370 aa):
MEVSNLSGATPGLAFPPGPESCSDSPSSGRSMGSTPGGLILPGREPPFSAFTVLVVTLLVLLIVATFLWN
L
LVLVTILRVRAFHRVPHNLVASTAVSDVLVAALVMPLSLVSELSVGRRWQLGRSLCHVWISFDVLCCTA
S
IWNVAAIALDRYWTITRHLQYTLRTRSRASALMIAITWALSALIALAPLLFGWGEAYDARLQRCQVSQE
P
SYAVFSTCGAFYLPLAVVLFVYWKIYKAAKFRFGRRRRAVVPLPATTQ
AKEAPPESEMVFTARRRATVT
F
QTSGDSWREQKEKRAAMMVGILIGVFVLCWIPFFLTELISPLCACSLPPIWKSIFLWLGYSNSFFNPLI
Y
TAFNKNYNNAFKSLFTKQR




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser