NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS27101.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
27101.1 Public Mus musculus 14 Slc7a8 21 106 86 CCDS HistoryNCBI Gene:50934Re-query CCDS DB by CCDS ID:27101.1See the combined annotation on chromosome 14 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 27101.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000022787 ENSMUSP00000022787 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000022787Link to Ensembl Protein Viewer:ENSMUSP00000022787Re-query CCDS DB by Nucleotide ID:ENSMUST00000022787Re-query CCDS DB by Protein ID:ENSMUSP00000022787
Original member Current member NCBI NM_016972.2 NP_058668.1 Accepted alive Link to Nucleotide Sequence:NM_016972.2Link to Protein Sequence:NP_058668.1Re-query CCDS DB by Nucleotide ID:NM_016972Re-query CCDS DB by Protein ID:NP_058668Link to BLink:NP_058668.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_058668.1 531 Q9QXW9 531 100% 0 0

Chromosomal Locations for CCDS 27101.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 14 (NC_000080.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 14Link to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14See the combined annotation on chromosome 14 in Sequence Viewer

Chromosome Start Stop Links
14 54724094 54724251 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54724738 54724915 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54726735 54726884 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54729333 54729429 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54733180 54733283 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54735054 54735177 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54735724 54735877 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54737540 54737665 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54758439 54758590 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54759541 54759745 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 54781180 54781327 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1596 nt):
ATGGAAAAGGGAGCCCGCCAGCGAAACAACACCGCGAAGAACCACCCGGGTTCTGACACCAGCCCTGAGG
CC
GAGGCTAGCTCGGGAGGGGGCGGAGTAGCCCTGAAGAAAGAGATCGGATTGGTCAGCGCCTGTGGTAT
C
ATTGTAGGGAACATCATTGGCTCCGGAATCTTTGTCTCACCGAAAGGTGTGCTGGAAAACGCGGGCTCT
GTG
GGCCTTGCTCTCATTGTCTGGATCGTGACAGGCATCATCACAGCCGTGGGAGCTCTCTGCTATGCTG
AG
CTAGGCGTCACCATCCCTAAGTCTGGAGGTGATTACTCTTATGTGAAGGACATCTTCGGAGGACTGGC
T
GGGTTCCTGCGGCTGTGGATTGCTGTGCTGGTGATCTACCCCACCAACCAAGCTGTCATCGCCCTCACC
TTC
TCCAACTACGTGCTGCAGCCGCTCTTCCCTACCTGCTTCCCCCCTGAGTCCGGTCTGCGACTCCTGG
CT
GCCATCTGTTTGTTGCTCCTCACATGGGTCAACTGCTCCAGTGTCCGATGGGCCACCCGGGTTCAAGA
T
ATCTTCACAGCTGGGAAGCTCCTGGCCCTGGCTCTGATCATCATCATGGGTATTGTGCAGATATGCAAA
G
GA
GAATTCTTCTGGCTGGAGCCAAAGAATGCATTTGAGAATTTCCAAGAACCTGACATCGGCCTCGTTG
CT
CTGGCATTCCTCCAGGGCTCCTTTGCCTATGGTGGCTGGAACTTCCTTAATTATGTGACTGAGGAACT
T
GTGGATCCTTACAAGAACCTTCCTAGAGCCATCTTCATCTCCATCCCACTGGTCACATTTGTGTACGTC
TTT
GCTAATATTGCATACGTCACTGCAATGTCCCCCCAGGAGCTGCTAGCCTCCAATGCAGTTGCTGTGA
CT
TTTGGAGAGAAACTCCTCGGGGTCATGGCCTGGATCATGCCCATTTCTGTTGCCCTGTCCACGTTTGG
T
GGAGTCAATGGCTCCCTCTTCACCTCCTCCCGGCTGTTCTTTGCTGGAGCCAGAGAAGGCCACCTTCCC
AGT
GTGTTGGCCATGATCCACGTGAAGCGCTGCACTCCAATCCCAGCCCTGCTCTTCACATGCCTCTCCA
CC
CTGCTGATGCTGGTCACCAGTGACATGTACACACTCATCAACTATGTGGGCTTCATCAACTACCTCTT
C
TATGGGGTAACGGTTGCAGGACAGATAGTCCTTCGCTGGAAGAAGCCTGACATTCCCCGCCCCATCAAG
GTC
AGCCTGCTGTTTCCCATTATCTACCTGCTGTTCTGGGCCTTCCTGCTGATCTTCAGCCTGTGGTCAG
AG
CCAGTGGTGTGTGGCATTGGCCTGGCCATTATGCTGACAGGAGTTCCTGTCTACTTCCTGGGTGTCTA
C
TGGCAACACAAACCCAAGTGTTTCAATGACTTCATTAAGTCCCTAACCCTAGTGAGTCAGAAGATGTGT
GTG
GTCGTGTATCCCCAGGAGGGGAACTCGGGGGCTGAGGAAACAACTGATGACTTAGAGGAGCAACACA
AG
CCCATCTTCAAGCCTACTCCTGTCAAGGACCCGGATTCGGAGGAGCAGCCCTGA


Translation (531 aa):
MEKGARQRNNTAKNHPGSDTSPEAEASSGGGGVALKKEIGLVSACGIIVGNIIGSGIFVSPKGVLENAGS
V
GLALIVWIVTGIITAVGALCYAELGVTIPKSGGDYSYVKDIFGGLA
GFLRLWIAVLVIYPTNQAVIALT
F
SNYVLQPLFPTCFPPESGLRLLAAICL
LLLTWVNCSSVRWATRVQDIFTAGKLLALALIIIMGIVQICK
G
EFFWLEPKNAFENFQEPDIGLVALAFLQGSFAYGGWNFLNYVTEELVDPYKNLPRAIFISIPLVTFVYV
F
ANIAYVTAMSPQELLASNAVAV
TFGEKLLGVMAWIMPISVALSTFGGVNGSLFTSSRLFFAGAREGHLP
S
VLAMIHVKRCTPIPALLFT
CLSTLLMLVTSDMYTLINYVGFINYLFYGVTVAGQIVLRWKKPDIPRPIK
V
SLLFPIIYLLFWAFLLIFSLWSEPVVCGIGLAIMLTGVPVYFLGVYWQHKPKCFNDFI
KSLTLVSQKMC
V
VVYPQEGNSGAEETTDDLEEQHKPIFKPTPVKDPDSEEQP




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser