NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS51509.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
51509.1 Public Mus musculus 5 Wdr19 19 105 81 CCDS HistoryNCBI Gene:213081Re-query CCDS DB by CCDS ID:51509.1See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 51509.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000041892 ENSMUSP00000038098 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000041892Link to Ensembl Protein Viewer:ENSMUSP00000038098Re-query CCDS DB by Nucleotide ID:ENSMUST00000041892Re-query CCDS DB by Protein ID:ENSMUSP00000038098
Original member Current member NCBI NM_153391.2 NP_700440.2 Accepted alive Link to Nucleotide Sequence:NM_153391.2Link to Protein Sequence:NP_700440.2Re-query CCDS DB by Nucleotide ID:NM_153391Re-query CCDS DB by Protein ID:NP_700440Link to BLink:NP_700440.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_700440.2 1341 Q3UGF1-1 1341 100% 0 0

Chromosomal Locations for CCDS 51509.1

Assembly GRCm38.p3 (GCF_000001635.23)

On '+' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 5Link to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 65199755 65199760 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 65202560 65202651 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 65202952 65203017 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 65206410 65206535 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 65212815 65212930 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 65215803 65215918 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 65220436 65220516 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 65221619 65221731 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 65221990 65222163 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 65223029 65223099 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 65223511 65223683 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 65223769 65223883 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 65224688 65224794 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 65225291 65225413 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 65227044 65227193 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 65228186 65228333 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 65228456 65228660 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 65230956 65231115 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 65231278 65231388 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 65234097 65234206 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 65239558 65239615 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 65240855 65240995 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 65241072 65241154 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 65241513 65241596 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 65243319 65243465 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 65244120 65244244 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 65245796 65245908 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 65247461 65247529 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 65248790 65248867 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 65250899 65250995 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 65252279 65252403 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 65255051 65255132 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 65256281 65256431 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 65257002 65257125 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 65257736 65257812 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 65258104 65258212 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (4026 nt):
ATGAAGCGTGTTTTCTCCCTGCTAGAAAAGTCTTGGCTTGGTGCTCCGATACAATTTGCCTGGCAAAAAT
CA
TCAGGAAACTACCTTGCAGTAACAGGAGCTGATTATATTGTTAAAATCTTTGATCGCCATGGCCAAAA
A
AGAAGTGAAATTAGCTTGCCTGGCAACTGTGTTACCATGGATTGGGATAAAGATGGCGATATCCTGGCA
GTG
ATTGCTGAGAAGTCTAGTTGCATTTATCTATGGGATGCCAACACAAATAAAACCAGCCAGCTGGACA
AT
GGCATGAGGGATCAAATGTCTTTCCTTCTTTGGTCAAAAATTGGAAGTTTCCTGGCTGTTGGGACCAT
T
AAAGGAAATTTGCTCATTTATAATCATCAGACATCTCGAAAGATTCCTGTTCTTGGAAAACATACTAAG
AAA
ATCACATGTGGATGTTGGAATTCAGAGAATCTCCTTGCTTTGGGAGGTGAAGATAAAATGATTACAG
TT
AGTAACCAGGAAGGCGACACAATAAGACAGACCCCAGTGAAATCAGAGCCAAGCGACATCAAGTTCTC
C
ATGAGCAAGACAGATGAGCGAATTTCTTCTGCTGAGAACACAATAAGTGCAGTGGTTGGCAAGAAAATG
CTG
TTTCTTTTTCATCTGAATGAACCAGATAACCCGGTGGATCTGGAGTTTCAGCAAGCCTATGGCAACA
TT
GTCTGCTATAGTTGGTATGGAGATGGCTACATCATGATTGGCTTTTCCCGAGGGACGTTTTTGGCTAT
T
TCTACTCACTTTCCGGAAGTTGGGCAAGAGATATTTAAGGCTCGTGACCATAAGGATAATCTAACCAGT
GTG
GCCTTGTCACAGACTCTGAACAAAGCTGCCACATGTGGCGATAACTGCATAAAAATCCATGATCTGA
CA
GAATTGAGAGACATGTATGCTATAATTAATCTGGATGATGAGAATAAAGGGCTGGGTACCTTATCCTG
G
ACTGATGATGGTCAGTTGCTAGCACTGTCTACCCAAAGAGGCTCACTGCATGTCTTCCTGACCAAGTTG
CCC
ATCCTCGGGGACGCCTGTCACACAAGGATTGCGTATCTCACCTCCCTCCTTGAGGTCACCGTGGCCA
AC
CTCATTGAAGGAGAGCCGCCAATCACAGTCTCTGTGGATGTGGAACCCACCTTTGTCGCAGTAGGGCT
C
TATCATCTGGCCGTGGGGATGAATAACCGGGCTTGGTTTTATGTCCTTGGTGAAAATGTTGTCAAAAAG
TTA
AAAGATGTGGAATATCTGGGAACCGTGGCCAGCATCTGCCTTCATTCTGACTACGCCGCTGCACTCT
TT
GAAGGCAAAATCCAGTTACATTTGATAGAAAATGAAATGTTGGACGCTCAGGAAGAGCGTGAGACTCG
G
CTCTTTCCAGCAGTGGATGATAAGTGCCGGATTTTATGCCACGCCCTAACTAGTGATTTCCTCATCTAC
GGA
ACTGATACTGGCATCATTCACTATTTCTTCATCGAAGACTGGCAGTTCGTTAATGATTACCGGCATC
CT
GTTGGTGTGAAGAAGCTATTTCCTGATCCAAATGGAACCAGATTGGTTTTCATTGATGAGAAGAGTGA
T
GGATTTGTTTACTGTCCTGTTAATGATGCGACCTATGAGATTCCAGACTTCTCACCAACCATTAAAGGT
GTT
CTTTGGGAAAACTGGCCGATGGACAAAGGTGTCTTTATCGCCTATGATGATGACAAGGTGTATACAT
AT
GCGTTTCACAAGGACACCATCCAAGGATCCAAGGTTATTTTGGCTGGCAGCACCAAACTTCCCTTCTC
C
CATAAGCCTTTGCTGTTATACAATGGAGAACTGACCTGCCAGACACAGAGTGGGAAAATCAACTCCATC
TAC
CTCAGCACCCACAGCTTCCTTGGCAGCATGAAAGACACGGAGCCTACTGACCTGAGGCAAATGCTGA
CG
CAGACCCTGCTGCTCAAGCGGTTTTCTGATGCTTGGGATATATGCAAGATGCTAAATGACCGCACTTC
G
TGGAGTGAGCTGGCCAAAGCCTGTCTGCATCACATGGAGGTGGAGTTTGCTATCCGAGTGTCCCGGACA
ATG
GGGGATGTTGGCACAGTGATGTCGTTGGAACAAATAAAGGGAATCGAGGACTACAATCTTTTGGCAG
GA
CATCTCGCCATGTTTACTAATGACTTCAACCTGGCCCAGGACCTGTACCTGGCATCCAACTGCCCTGT
G
GCAGCCCTGGAGATGCGGCGGGACCTGCAGCACTGGGACAGCGCTCTGCAGCTGGCAAAGCGCCTGGCC
CCG
GACCAGATACCCTTCATATCCAAAGAGTACGCCATCCAGCTGGAGTTCACAGGCGATTATGTAAACG
CT
CTGGCTCATTACGAGAAGGGCATCACCGGTGATAATAAGGAACACGACGAAGTGTGCCTGGCCGGAGT
G
GCTCAGATGTCCATTCGAATGGGGGACATCCGCAGAGGGGCTAACCAAGCCCTCAAGCACCCCAGCAGG
GTC
CTCAAAAGAGACTGTGGAGCCATTCTGGAGAACATGAAGCAATTTTCAGAAGCTGCCCAGCTGTACG
AA
AAGGGCCAATATTATGACAGAGCTGCCTCGGTCTACATCCGCTGCAAGAACTGGGCAAAAGTTGGCGA
A
CTTCTCCCTCATGTCTCCTCTCCTAAGATCCACTTGCAGTATGCCAAAGCCAAGGAGGCAGACGGAAGG
TAC
AAGGAAGCCGTGGTGGCGTATGAAAATGCAAAGCAATGGAACAGTGTCATCCGCATCTACCTGGACC
AC
CTCAACAACCCCGAAAAGGCCGTGAGCATCGTCAGAGAGACCCAGTCTCTGGACGGAGCCAAGATGGT
A
GCCAGGTTCTTTCTGCAGCTTGGTGACTATGGGTCTGCCATCCAGTTTCTGGTTCTGTCCAAATGTAAC
AAT
GAAGCCTTCACCTTGGCTCAGCAGCACAACAAAATGGAAATCTACGCAGACATCATTGGTGCTGAAG
AC
ACAACTAATGAAGACTATCAAAGTATCGCCTTATATTTTGAAGGAGAAAAAAGACATTTTCAGGCTGG
A
AAATTCTTCTTACTGTGTGGCCAGTATTCACGGGCACTAAAGCACTTCCTGAAATGCCCAAGCTCAGAA
GAT
AATGTGGCAATAGAAATGGCAATCGAAACTGTGGGCCAGGCCAAAGATGAACTGCTGACCAATCAGC
TG
ATCGACCACCTGATGGGGGAGAGCGATGGCATGCCAAAGGACGCCAAGTACCTGTTCCGCTTGTACAT
G
GCGCTAAAGCAGTACCGTGAAGCAGCCCGGACCGCCATCATCATCGCCAGAGAAGAGCAGTCTGCAGGA
AAC
TATCGGAATGCACACGATGTTCTTTTCAGTATGTACGCAGAACTTAAAGCCCAGAAGATCAAGATCC
CC
TCCGAAATGGCCACCAACCTCATGATCCTGCACAGTTACATTCTCGTGAAGATTCATGTTAAGAGTGG
A
GACCATATGAAGGGAGCGCGCATGCTCATTCGGGTGGCCAACAATATCAGCAAGTTCCCATCACACATC
GTG
CCTATCCTGACGTCTACTGTGATTGAGTGTCATAGGGCAGGCCTGAAAAACTCTGCCTTCAGCTTTG
CA
GCTATGCTGATGAGGCCTGAATACCGCAACAAAATTGATGCCAAGTACAAAAAGAAAATTGAGGCGAT
G
GTCAGGAGACCCGATACTTCAGAGACAGAAGAGGCCACCACCCCATGTCCATTCTGCCAGTTTCTTCTC
CCA
GAATGTGAGCTCCTCTGTCCTGGCTGTAAAAACAACATTCCCTATTGCATTGCAACAGGCCGACACA
TG
TTGAAAGACGACTGGACAATGTGCCCGCATTGTGGCTTCCCTGCTCTGTACTCAGAATTCAAGATCTT
A
CTAAACAGTGAAAGCACGTGTCCTATGTGTTCAGAAAGATTAAACTCCAGTCAACTGAAAAAAATTACA
GAC
TGCTCGCAGTACCTACGGACAGAGATGGAATAG


Translation (1341 aa):
MKRVFSLLEKSWLGAPIQFAWQKSSGNYLAVTGADYIVKIFDRHGQKRSEISLPGNCVTMDWDKDGDILA
V
IAEKSSCIYLWDANTNKTSQLDNGM
RDQMSFLLWSKIGSFLAVGTIKGNLLIYNHQTSRKIPVLGKHTK
K
ITCGCWNSENLLALGGEDKMITVSNQEGDTIRQ
TPVKSEPSDIKFSMSKTDERISSAENTISAVVGKKM
L
FLFHLNEPDNPVDLEFQQAYGNIVCYS
WYGDGYIMIGFSRGTFLAISTHFPEVGQEIFKARDHKDNLTS
V
ALSQTLNKAATCGDN
CIKIHDLTELRDMYAIINLDDENKGLGTLSWTDDGQLLALSTQRGSLHVFLTKL
P
ILGDACHTRIAYLTSLLEVTVANLIEG
EPPITVSVDVEPTFVAVGLYHLAVGMNNRAWFYVLGENVVKK
L
KDVEYLGTVASICLHSDYAAALFEGKIQLHL
IENEMLDAQEERETRLFPAVDDKCRILCHALTSDFLIY
G
TD
TGIIHYFFIEDWQFVNDYRHPVGVKKLFPDPNGTRLVFIDEKSDGFVYCPVNDATYEIPDFSPTIKG
V
LWENWPMDKGVFIAYDDDKVYTYAFHKDTIQ
GSKVILAGSTKLPFSHKPLLLYNGELTCQTQSGKINSI
Y
LSTHSFLGSMKDTEPTDLRQMLTQTLLLK
RFSDAWDICKMLNDRTSWSELAKACLHHMEVEFAIRVSRT
M
GDVGTVMSLEQIK
GIEDYNLLAGHLAMFTNDFNLAQDLYLASNCPVAALEMRRDLQHWDSALQLAKRLA
P
DQIPFISKEYAIQLEF
TGDYVNALAHYEKGITGDNKEHDEVCLAGVAQMSIRMGDIRRGANQALKHPSR
V
LKRDCGAILENMK
QFSEAAQLYEKGQYYDRAASVYIRCKNWAKVGELLPHVSSPKIHLQYAKAKEADGR
Y
KEAVVAYENAKQWNSVIRIYLDHLNNPEKAVSIVRETQSLDGAKMVA
RFFLQLGDYGSAIQFLVLSKCN
N
EAFTLAQQHNKMEIYADII
GAEDTTNEDYQSIALYFEGEKRHFQAGKFFLLCGQYSRALKHFLKCPSSE
D
NVAIEMAIET
VGQAKDELLTNQLIDHLMGESDGMPKDAKYLFRLYMALKQYREAARTAIIIAREEQSAG
N
YRNAHDVLFSMYAELKAQKIKIPSEMATNLMILHSYILVK
IHVKSGDHMKGARMLIRVANNISKFPSHI
V
PILTSTVIECHRAGLKNSAFSFAAMLMRPEYRNKIDAKYKKKIEAMV
RRPDTSETEEATTPCPFCQFLL
P
ECELLCPGCKNNIPYCIAT
GRHMLKDDWTMCPHCGFPALYSEFKILLNSESTCPMCSERLNSSQLKKIT
D
CSQYLRTEME




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser