NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS16716.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
16716.1 Public Mus musculus 2 Mertk 21 106 86 CCDS HistoryNCBI Gene:17289Re-query CCDS DB by CCDS ID:16716.1See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 16716.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000014505 ENSMUSP00000014505 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000014505Link to Ensembl Protein Viewer:ENSMUSP00000014505Re-query CCDS DB by Nucleotide ID:ENSMUST00000014505Re-query CCDS DB by Protein ID:ENSMUSP00000014505
Original member Current member EBI,WTSI OTTMUST00000036392 OTTMUSP00000016359 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000036392Link to Vega Protein Viewer:OTTMUSP00000016359Re-query CCDS DB by Nucleotide ID:OTTMUST00000036392Re-query CCDS DB by Protein ID:OTTMUSP00000016359
Original member NCBI NM_008587.1 NP_032613.1 Updated not alive Link to Nucleotide Sequence:NM_008587.1Link to Protein Sequence:NP_032613.1Re-query CCDS DB by Nucleotide ID:NM_008587Re-query CCDS DB by Protein ID:NP_032613
Current member NCBI NM_008587.2 NP_032613.1 Accepted alive Link to Nucleotide Sequence:NM_008587.2Link to Protein Sequence:NP_032613.1Re-query CCDS DB by Nucleotide ID:NM_008587Re-query CCDS DB by Protein ID:NP_032613Link to BLAST:NP_032613.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_032613.1 994 Q60805 994 100% 0 0

Chromosomal Locations for CCDS 16716.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 128699046 128699103 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 128729186 128729594 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 128736563 128736663 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 128738196 128738369 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 128750100 128750186 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 128751907 128752022 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 128759043 128759226 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 128762077 128762228 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 128771347 128771500 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 128776286 128776439 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 128777413 128777498 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 128778915 128779010 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 128779792 128779872 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 128782523 128782615 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 128783892 128784010 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 128790217 128790326 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 128792946 128793105 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 128794442 128794578 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 128801154 128801667 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2985 nt):
ATGGTTCTGGCCCCACTGCTACTGGGGCTGCTGCTGCTACCCGCGCTCTGGAGTGGAGGCACTGCCGAGA
AG
TGGGAAGAGACCGAGCTAGATCAGCTATTTTCAGGGCCTTTACCAGGGAGACTCCCAGTCAACCACAG
G
CCATTCTCTGCTCCTCACTCCAGCCGGGACCAGCTGCCACCACCCCAGACTGGAAGATCACATCCAGCA
CAC
ACAGCCGCTCCCCAGGTGACCTCCACAGCATCAAAGCTCCTACCTCCTGTTGCGTTTAATCACACCA
TT
GGACACATAGTACTGTCGGAACATAAAAATGTCAAATTTAATTGCTCCATCAATATTCCTAACACATA
C
CAAGAAACAGCTGGCATTTCATGGTGGAAAGATGGAAAGGAATTGCTCGGGGCACATCATTCAATCACA
CAG
TTTTATCCTGATGAGGAAGGGGTATCAATAATTGCATTGTTCAGCATAGCCAGTGTGCAGCGCTCAG
AC
AATGGGTCGTACTTCTGTAAGATGAAGGTGAACAATAGAGAGATTGTATCTGATCCCATATACGTGGA
A
GTTCAAGGACTCCCTTACTTTATTAAGCAGCCTGAGAGTGTGAATGTCACCAGAAACACAGCCTTCAAC
CTC
ACCTGCCAGGCCGTGGGCCCTCCTGAGCCCGTCAATATCTTCTGGGTTCAAAATAGCAGCCGTGTTA
AT
GAAAAACCGGAAAGGTCCCCGTCTGTCCTAACCGTACCTGGTCTGACAGAGACAGCAGTCTTCAGCTG
T
GAGGCCCACAATGACAAAGGACTGACGGTGTCCAAGGGTGTACATATCAACATCAAAGTAATCCCCTCC
CCG
CCCACTGAAGTCCATATCCTCAACAGTACAGCACACAGCATCCTGGTCTCCTGGGTCCCTGGTTTTG
AT
GGCTACTCCCCACTTCAGAACTGCAGCATTCAGGTCAAGGAAGCTGACCGGCTGAGTAATGGCTCAGT
C
ATGGTTTTTAATACCTCTGCTTCGCCACATCTGTATGAGATCCAGCAGCTGCAAGCCCTGGCTAATTAC
AGC
ATCGCTGTGTCCTGTCGGAATGAGATTGGCTGGTCTGCAGTAAGCCCTTGGATTCTGGCCAGCACAA
CA
GAAGGAGCTCCATCTGTAGCACCTTTAAACATCACTGTGTTTCTGAACGAATCTAACAATATCCTGGA
T
ATTAGATGGACGAAGCCTCCAATTAAGCGGCAGGATGGGGAACTGGTGGGCTACCGGATATCTCACGTG
TGG
GAAAGCGCAGGGACTTACAAAGAGCTTTCTGAAGAAGTCAGCCAGAATGGCAGCTGGGCTCAGATTC
CT
GTCCAAATCCACAATGCCACCTGCACAGTGAGAATCGCGGCCATTACTAAAGGGGGCATCGGGCCCTT
C
AGTGAGCCAGTGAATATCATCATTCCTGAACACAGTAAGGTAGATTACGCACCCTCGTCAACCCCAGCC
CCT
GGCAACACCGACTCTATGTTCATCATCCTCGGCTGCTTCTGTGGATTCATTTTAATCGGGTTAATTT
TG
TGTATTTCTCTGGCCCTCAGAAGGAGAGTCCAGGAAACAAAGTTTGGGGGAGCATTCTCTGAGGAGGA
T
TCCCAACTGGTCGTAAATTATAGAGCGAAGAAGTCCTTCTGCCGGCGAGCCATCGAGCTTACCTTGCAG
AGC
CTGGGAGTGAGCGAGGAGCTGCAGAATAAGCTGGAAGATGTTGTGATTGACAGAAACCTTCTGGTTC
TC
GGCAAAGTTCTGGGTGAAGGAGAGTTTGGGTCTGTAATGGAAGGAAATTTGAAGCAAGAAGATGGGAC
T
TCTCAGAAGGTGGCAGTGAAGACCATGAAGTTGGACAACTTTTCTCAACGGGAGATCGAGGAGTTTCTC
AGC
GAAGCAGCATGCATGAAAGACTTCAACCACCCAAATGTCATCCGACTTCTAGGCGTGTGTATAGAAC
TG
AGCTCTCAAGGCATCCCGAAGCCCATGGTGATTTTACCCTTCATGAAATACGGAGACCTCCACACCTT
C
CTGTTATATTCCCGATTAAACACAGGACCCAAGTACATTCACCTGCAGACACTACTGAAGTTCATGATG
GAC
ATTGCCCAGGGAATGGAGTATCTGAGCAACAGGAATTTTCTTCATAGGGATTTGGCAGCTCGAAACT
GC
ATGTTGCGGGATGACATGACTGTCTGCGTGGCAGACTTTGGCCTCTCAAAGAAGATTTACAGTGGTGA
T
TATTACCGCCAAGGCCGCATTGCCAAAATGCCTGTGAAGTGGATCGCCATCGAGAGCCTGGCGGACCGA
GTC
TACACAAGCAAAAGTGACGTGTGGGCTTTTGGCGTGACCATGTGGGAAATAACAACACGGGGAATGA
CT
CCCTATCCCGGAGTTCAGAACCATGAGATGTACGACTACCTTCTCCACGGCCACAGGCTGAAGCAGCC
T
GAGGACTGCTTGGATGAACTGTATGACATCATGTACTCTTGCTGGAGTGCTGATCCCTTGGATCGACCC
ACC
TTCTCTGTGTTGAGGCTGCAGCTGGAAAAGCTCTCCGAGAGTTTGCCTGATGCGCAGGACAAAGAAT
CC
ATCATCTACATCAATACCCAGTTGCTAGAGAGCTGCGAGGGCATAGCCAATGGGCCCTCACTCACGGG
G
CTAGACATGAACATTGACCCTGACTCCATCATTGCCTCTTGCACACCAGGCGCTGCCGTCAGCGTGGTC
ACG
GCAGAAGTTCACGAGAACAACCTTCGTGAGGAAAGATACATCTTGAATGGGGGCAATGAGGAATGGG
AA
GATGTGTCCTCCACTCCTTTTGCTGCAGTCACACCTGAAAAGGATGGTGTCTTACCGGAGGACAGACT
C
ACCAAAAATGGCGTCTCCTGGTCTCACCATAGTACACTACCCTTGGGGAGCCCATCACCAGATGAACTT
TTA
TTTGTAGATGACTCCTTGGAAGACTCTGAAGTTCTGATGTGA


Translation (994 aa):
MVLAPLLLGLLLLPALWSGGTAEKWEETELDQLFSGPLPGRLPVNHRPFSAPHSSRDQLPPPQTGRSHPA
H
TAAPQVTSTASKLLPPVAFNHTIGHIVLSEHKNVKFNCSINIPNTYQETAGISWWKDGKELLGAHHSIT
Q
FYPDEEGVSIIALF
SIASVQRSDNGSYFCKMKVNNREIVSDPIYVEVQGLPYFIKQPESVNVTRNTAFN
L
TCQAVGPPEPVNIFWVQNSSRVNEKPERSPSVLTVP
GLTETAVFSCEAHNDKGLTVSKGVHINIKVIPS
P
PTEVHILNSTAHSILVSWVPGFDGYSPLQNCSIQ
VKEADRLSNGSVMVFNTSASPHLYEIQQLQALANY
S
IAVSCRNEIGWSAVSPWILASTTEG
APSVAPLNITVFLNESNNILDIRWTKPPIKRQDGELVGYRISHV
W
ESAGTY
KELSEEVSQNGSWAQIPVQIHNATCTVRIAAITKGGIGPFSEPVNIIIPEHSKVDYAPSSTPA
P
GNTDSMFIILGCFCGFILIGLILCISLALRRRVQETKF
GGAFSEEDSQLVVNYRAKKSFCRRAIELTLQ
S
LGVSEELQNKLEDVVIDRNLLVLGKVLGE
GEFGSVMEGNLKQEDGTSQKVAVKTMKLDNFSQREIEEFL
S
EAACMKDFNHPNVIRLL
GVCIELSSQGIPKPMVILPFMKYGDLHTFLLYSRLNTGPKYIHLQTLLKFMM
D
IAQGMEYLSNRNFLHRDLAARNC
MLRDDMTVCVADFGLSKKIYSGDYYRQGRIAKMPVKWIAIESLADR
V
YTSKSDV
WAFGVTMWEITTRGMTPYPGVQNHEMYDYLLHGHRLKQPEDCLDELYDIMYSCWSADPLDRP
T
FSVLRLQLEKLSESLPDAQDKESIIYINTQLLESCEGIANGPSLTGLDMNIDPDSIIASCTPGAAVSVV
T
AEVHENNLREERYILNGGNEEWEDVSSTPFAAVTPEKDGVLPEDRLTKNGVSWSHHSTLPLGSPSPDEL
L
FVDDSLEDSEVLM




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser