NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS35075.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
35075.1 Public Homo sapiens 9 ZNF782 22 109 92 CCDS HistoryNCBI Gene:158431Re-query CCDS DB by CCDS ID:35075.1Re-query CCDS DB by GeneID:158431See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 35075.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000481138.5 ENSP00000419397.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000481138.5Link to Ensembl Protein Viewer:ENSP00000419397.1Re-query CCDS DB by Nucleotide ID:ENST00000481138Re-query CCDS DB by Protein ID:ENSP00000419397
Original member Current member EBI,WTSI ENST00000535338.5 ENSP00000440624.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000535338.5Link to Ensembl Protein Viewer:ENSP00000440624.2Re-query CCDS DB by Nucleotide ID:ENST00000535338Re-query CCDS DB by Protein ID:ENSP00000440624
Original member NCBI NM_001001662.2 NP_001001662.1 Updated not alive Link to Nucleotide Sequence:NM_001001662.2Link to Protein Sequence:NP_001001662.1Re-query CCDS DB by Nucleotide ID:NM_001001662Re-query CCDS DB by Protein ID:NP_001001662
Current member NCBI NM_001001662.3 NP_001001662.1 Accepted alive Link to Nucleotide Sequence:NM_001001662.3Link to Protein Sequence:NP_001001662.1Re-query CCDS DB by Nucleotide ID:NM_001001662Re-query CCDS DB by Protein ID:NP_001001662Link to BLAST:NP_001001662.1
Original member NCBI NM_001346991.1 NP_001333920.1 Updated not alive Link to Nucleotide Sequence:NM_001346991.1Link to Protein Sequence:NP_001333920.1Re-query CCDS DB by Nucleotide ID:NM_001346991Re-query CCDS DB by Protein ID:NP_001333920
Current member NCBI NM_001346991.2 NP_001333920.1 Accepted alive Link to Nucleotide Sequence:NM_001346991.2Link to Protein Sequence:NP_001333920.1Re-query CCDS DB by Nucleotide ID:NM_001346991Re-query CCDS DB by Protein ID:NP_001333920Link to BLAST:NP_001333920.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001001662.1 699 Q6ZMW2 699 100% 0 0
NP_001333920.1 699 Q6ZMW2 699 100% 0 0

Chromosomal Locations for CCDS 35075.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 9 (NC_000009.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 96817923 96819778 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 96827080 96827181 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 96844890 96845016 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 96851947 96851961 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2100 nt):
ATGAACACATTTCAGGCATCAGTGTCATTCCAGGACGTGACTGTGGAATTCAGCCAGGAGGAGTGGCAGC
AC
ATGGGCCCTGTTGAGAGGACCCTGTACAGAGATGTGATGCTGGAGAACTACAGCCACCTCGTCTCAGT
G
GGCTACTGCTTTACAAAACCAGAACTGATCTTCACATTGGAACAAGGAGAAGATCCATGGTTATTAGAG
AAA
GAGAAAGGATTTCTAAGCAGGAACTCCCCAGAAGACTCCCAACCTGATGAAATCTCAGAGAAGAGCC
CA
GAAAATCAAGGCAAACATTTGTTGCAAGTTTTATTCACCAATAAATTATTGACTACAGAGCAAGAAAT
T
TCAGGAAAACCACATAATCGAGACATAAACATTTTTCGTGCAAGAATGATGCCTTGTAAATGTGACATT
GCG
GGGTCTGCTTGCCAGGGGCTCAGCCTGATGGCCCCACACTGTCAGTATTCAAAAGAAAAGGCTCATG
AG
CGTAATGTTTGTGACAAATGGCTCATCAGTATTAAGGATGGCAGAACTAACACTCAAGAGAAATCTTT
C
GCTTATAGTAAAATTGTGAAAACCCTCCATCATAAGGAGGAAGTTATTCAACATCAGACAATTCAGACT
CTG
GGGCAAGATTTTGAATATAATGAAAGTAGAAAAGCTTTTCTTGAAAAGGCTGCCCTTGTTACATCTA
AC
AGTACCCACCCAAAAGGAAAATCTTACAATTTCAATAAATTTGGGGAAAACAAATATGATAAATCAAC
C
TTTATTATTCCTCAGAACATGAATCCAGAGAAGAGTCACTATGAGTTTAATGATACTGGAAATTGTTTC
TGT
AGAATCACTCACAAAACTCTCACAGGAGGGAAATCCTTCAGCCAAAAGTCACACATTAGAGAACATC
AT
AGAGTTCATATAGGGGTGAAACCCTTTGAATATGGAAAAAGTTTCAACCGTAATTCAACCCTCCCAGT
G
CATCAGAGAACTCATGCAACAGATAAATACTCTGATTATCACCCATGTACAGAGACATTCAGCTACCAG
TCA
ACTTTCAGTGTACATCAGAAGGTTCACATAAGGGCAAAACCCTATGAGTATAATGAATGTGGGAAAT
CC
TGCTCTATGAATTCACACTTGATTTGGCCTCAGAAAAGTCACACAGGGGAGAAACCCTATGAATGTCC
T
GAGTGCGGGAAAGCCTTCAGTGAGAAGTCACGCCTAAGAAAACATCAGAGAACTCACACGGGAGAGAAA
CCA
TACAAATGTGATGGATGTGATAAAGCTTTCAGTGCAAAGTCAGGCCTAAGAATACACCAGAGAACCC
AC
ACAGGGGAGAAACCATTCGAATGTCATGAATGTGGGAAATCTTTTAACTATAAGTCAATCCTCATAGT
G
CATCAGAGAACTCACACAGGGGAGAAACCTTTTGAATGTAATGAATGCGGGAAATCTTTCAGCCATATG
TCA
GGCCTAAGGAATCACCGAAGAACTCACACAGGGGAAAGACCATATAAATGTGATGAATGTGGGAAAG
CT
TTCAAACTGAAGTCAGGCCTGAGGAAACATCATAGAACACACACAGGGGAGAAGCCCTACAAATGTAA
T
CAGTGTGGAAAAGCTTTCGGTCAGAAATCACAACTCAGAGGACATCATAGAATTCACACAGGGGAAAAA
CCC
TATAAATGTAATCATTGTGGGGAAGCTTTCAGTCAGAAATCAAACCTCAGAGTACATCACAGAACTC
AT
ACTGGGGAGAAACCCTATCAATGTGAGGAGTGTGGAAAAACATTCAGGCAGAAATCAAATCTCAGAGG
G
CATCAGAGAACTCACACTGGGGAGAAGCCCTATGAATGTAATGAATGTGGAAAAGCTTTCAGTGAGAAG
TCA
GTCCTAAGAAAACATCAGCGAACTCACACCGGGGAGAAACCATATAATTGTAATCAGTGTGGGGAAG
CT
TTCAGTCAGAAATCCAATCTCAGAGTACATCAGAGAACTCACACAGGGGAGAAACCCTATAAATGTGA
T
AAATGTGGGAGAACTTTCAGTCAAAAATCAAGCCTTAGAGAACATCAGAAAGCCCACCCAGGGGATTAA


Translation (699 aa):
MNTFQASVSFQDVTVEFSQEEWQHMGPVERTLYRDVMLENYSHLVSVGYCFTKPELIFTLEQGEDPWLLE
K
EKGFLSRNSP
EDSQPDEISEKSPENQGKHLLQVLFTNKLLTTEQEISGKPHNRDINIFRARMMPCKCDI
A
GSACQGLSLMAPHCQYSKEKAHERNVCDKWLISIKDGRTNTQEKSFAYSKIVKTLHHKEEVIQHQTIQT
L
GQDFEYNESRKAFLEKAALVTSNSTHPKGKSYNFNKFGENKYDKSTFIIPQNMNPEKSHYEFNDTGNCF
C
RITHKTLTGGKSFSQKSHIREHHRVHIGVKPFEYGKSFNRNSTLPVHQRTHATDKYSDYHPCTETFSYQ
S
TFSVHQKVHIRAKPYEYNECGKSCSMNSHLIWPQKSHTGEKPYECPECGKAFSEKSRLRKHQRTHTGEK
P
YKCDGCDKAFSAKSGLRIHQRTHTGEKPFECHECGKSFNYKSILIVHQRTHTGEKPFECNECGKSFSHM
S
GLRNHRRTHTGERPYKCDECGKAFKLKSGLRKHHRTHTGEKPYKCNQCGKAFGQKSQLRGHHRIHTGEK
P
YKCNHCGEAFSQKSNLRVHHRTHTGEKPYQCEECGKTFRQKSNLRGHQRTHTGEKPYECNECGKAFSEK
S
VLRKHQRTHTGEKPYNCNQCGEAFSQKSNLRVHQRTHTGEKPYKCDKCGRTFSQKSSLREHQKAHPGD




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser