NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS3227.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
3227.1 Public Homo sapiens 3 ZNF639 22 109 92 CCDS HistoryNCBI Gene:51193Re-query CCDS DB by CCDS ID:3227.1Re-query CCDS DB by GeneID:51193See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 3227.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000326361.7 ENSP00000325634.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000326361.7Link to Ensembl Protein Viewer:ENSP00000325634.3Re-query CCDS DB by Nucleotide ID:ENST00000326361Re-query CCDS DB by Protein ID:ENSP00000325634
Original member Current member EBI,WTSI ENST00000496856.5 ENSP00000417740.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000496856.5Link to Ensembl Protein Viewer:ENSP00000417740.1Re-query CCDS DB by Nucleotide ID:ENST00000496856Re-query CCDS DB by Protein ID:ENSP00000417740
Original member Current member EBI,WTSI ENST00000484866.5 ENSP00000418766.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000484866.5Link to Ensembl Protein Viewer:ENSP00000418766.1Re-query CCDS DB by Nucleotide ID:ENST00000484866Re-query CCDS DB by Protein ID:ENSP00000418766
Original member Current member EBI,WTSI ENST00000621687.1 ENSP00000477626.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000621687.1Link to Ensembl Protein Viewer:ENSP00000477626.1Re-query CCDS DB by Nucleotide ID:ENST00000621687Re-query CCDS DB by Protein ID:ENSP00000477626
Original member NCBI NM_001303425.1 NP_001290354.1 Updated not alive Link to Nucleotide Sequence:NM_001303425.1Link to Protein Sequence:NP_001290354.1Re-query CCDS DB by Nucleotide ID:NM_001303425Re-query CCDS DB by Protein ID:NP_001290354
Current member NCBI NM_001303425.2 NP_001290354.1 Accepted alive Link to Nucleotide Sequence:NM_001303425.2Link to Protein Sequence:NP_001290354.1Re-query CCDS DB by Nucleotide ID:NM_001303425Re-query CCDS DB by Protein ID:NP_001290354Link to BLAST:NP_001290354.1
Original member NCBI NM_001303426.1 NP_001290355.1 Updated not alive Link to Nucleotide Sequence:NM_001303426.1Link to Protein Sequence:NP_001290355.1Re-query CCDS DB by Nucleotide ID:NM_001303426Re-query CCDS DB by Protein ID:NP_001290355
Current member NCBI NM_001303426.2 NP_001290355.1 Accepted alive Link to Nucleotide Sequence:NM_001303426.2Link to Protein Sequence:NP_001290355.1Re-query CCDS DB by Nucleotide ID:NM_001303426Re-query CCDS DB by Protein ID:NP_001290355Link to BLAST:NP_001290355.1
Original member NCBI NM_016331.2 NP_057415.1 Updated not alive Link to Nucleotide Sequence:NM_016331.2Link to Protein Sequence:NP_057415.1Re-query CCDS DB by Nucleotide ID:NM_016331Re-query CCDS DB by Protein ID:NP_057415
Current member NCBI NM_016331.3 NP_057415.1 Accepted alive Link to Nucleotide Sequence:NM_016331.3Link to Protein Sequence:NP_057415.1Re-query CCDS DB by Nucleotide ID:NM_016331Re-query CCDS DB by Protein ID:NP_057415Link to BLAST:NP_057415.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001290354.1 485 Q9UID6 485 100% 0 0
NP_001290355.1 485 Q9UID6 485 100% 0 0
NP_057415.1 485 Q9UID6 485 100% 0 0

Chromosomal Locations for CCDS 3227.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 3 (NC_000003.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 179328294 179328351 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 179329618 179329728 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 179332989 179333123 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 179333269 179334422 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1458 nt):
ATGAATGAGTATCCTAAAAAAAGAAAAAGGAAGACTCTACACCCTTCTCGTTATTCAGATTCCTCTGGAA
TA
AGCAGAATTGCAGATGGATTCAATGGAATTTTCTCTGATCATTGTTACAGTGTCTGTTCTATGAGACA
G
CCAGATTTAAAATATTTTGACAACAAAGATGATGATTCTGATACCGAGACGTCAAATGACTTGCCAAAA
TTT
GCAGATGGAATCAAGGCCAGAAACAGAAATCAGAACTACCTGGTTCCCAGTCCTGTACTTAGAATTC
TA
GACCACACTGCCTTTTCTACAGAAAAATCTGCTGATATTGTAATTTGTGATGAAGAGTGTGACTCACC
T
GAATCAGTCAACCAGCAAACCCAAGAGGAGAGTCCTATAGAAGTTCACACTGCTGAAGATGTTCCAATT
GCT
GTAGAAGTGCATGCGATTTCTGAGGATTATGATATAGAGACAGAAAACAATTCCTCTGAGAGTCTCC
AA
GACCAAACTGATGAAGAACCGCCAGCTAAACTTTGTAAAATTCTTGACAAGAGCCAAGCTTTGAATGT
G
ACTGCCCAGCAGAAATGGCCTTTACTGAGAGCTAATAGCAGTGGCCTCTATAAATGTGAACTTTGTGAG
TTT
AACAGCAAATATTTTTCTGACTTAAAGCAGCATATGATCCTGAAGCATAAACGTACTGATTCAAATG
TG
TGTCGAGTATGCAAGGAAAGTTTCTCTACCAATATGCTTCTGATAGAACATGCCAAACTGCATGAAGA
G
GATCCCTACATTTGTAAATACTGTGATTATAAGACAGTAATTTTTGAGAACCTCAGCCAGCACATTGCA
GAC
ACCCATTTTAGTGATCACCTCTATTGGTGTGAACAGTGTGATGTACAGTTCTCCTCAAGCAGTGAAC
TC
TACCTACATTTCCAGGAGCACAGCTGTGATGAACAGTACTTGTGTCAGTTCTGTGAACATGAAACTAA
T
GATCCAGAAGACTTGCATAGCCATGTGGTAAATGAGCATGCATGTAAATTAATAGAGTTAAGTGATAAG
TAT
AACAATGGTGAACATGGACAGTATAGCCTCTTAAGCAAAATTACCTTTGACAAATGTAAAAACTTCT
TT
GTATGTCAAGTATGTGGTTTTCGGAGTAGACTTCACACAAATGTTAACAGGCATGTTGCTATTGAACA
T
ACAAAAATTTTTCCTCATGTTTGTGATGACTGTGGGAAAGGCTTTTCAAGTATGCTAGAATATTGCAAG
CAT
TTAAATTCACATTTATCTGAAGGGATTTATTTATGTCAATATTGTGAATATTCAACAGGACAAATTG
AA
GATCTTAAAATTCATCTAGATTTCAAGCATTCAGCTGACTTGCCTCATAAATGTAGTGACTGCTTGAT
G
AGGTTTGGAAATGAAAGGGAATTAATAAGTCACCTTCCAGTCCATGAGACAACTTGA


Translation (485 aa):
MNEYPKKRKRKTLHPSRYSDSSGISRIADGFNGIFSDHCYSVCSMRQPDLKYFDNKDDDSDTETSNDLPK
F
ADGIKARNRNQNYLVPSPVLRILDHTAFST
EKSADIVICDEECDSPESVNQQTQEESPIEVHTAEDVPI
A
VEVHAISEDYDIETENNSSESLQDQTDEEPPAKLCKILDKSQALNVTAQQKWPLLRANSSGLYKCELCE
F
NSKYFSDLKQHMILKHKRTDSNVCRVCKESFSTNMLLIEHAKLHEEDPYICKYCDYKTVIFENLSQHIA
D
THFSDHLYWCEQCDVQFSSSSELYLHFQEHSCDEQYLCQFCEHETNDPEDLHSHVVNEHACKLIELSDK
Y
NNGEHGQYSLLSKITFDKCKNFFVCQVCGFRSRLHTNVNRHVAIEHTKIFPHVCDDCGKGFSSMLEYCK
H
LNSHLSEGIYLCQYCEYSTGQIEDLKIHLDFKHSADLPHKCSDCLMRFGNERELISHLPVHETT




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser