NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS4015.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
4015.1 Public Homo sapiens 5 ZNF366 22 109 92 CCDS HistoryNCBI Gene:167465Re-query CCDS DB by CCDS ID:4015.1Re-query CCDS DB by GeneID:167465See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 4015.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000318442.5 ENSP00000313158.5 Accepted alive Link to Ensembl Transcript Viewer:ENST00000318442.5Link to Ensembl Protein Viewer:ENSP00000313158.5Re-query CCDS DB by Nucleotide ID:ENST00000318442Re-query CCDS DB by Protein ID:ENSP00000313158
Original member NCBI NM_152625.2 NP_689838.1 Updated not alive Link to Nucleotide Sequence:NM_152625.2Link to Protein Sequence:NP_689838.1Re-query CCDS DB by Nucleotide ID:NM_152625Re-query CCDS DB by Protein ID:NP_689838
Current member NCBI NM_152625.3 NP_689838.1 Accepted alive Link to Nucleotide Sequence:NM_152625.3Link to Protein Sequence:NP_689838.1Re-query CCDS DB by Nucleotide ID:NM_152625Re-query CCDS DB by Protein ID:NP_689838Link to BLAST:NP_689838.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_689838.1 744 Q8N895 744 100% 0 0

Chromosomal Locations for CCDS 4015.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 5 (NC_000005.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 72443756 72444291 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 72447243 72447417 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 72456404 72456595 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 72460165 72461496 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2235 nt):
ATGCAGAAGGAAATGAAGATGATCAAAGACGAGGATGTGCATTTCGACTTGGCTGTGAAGAAGACCCCCT
CC
TTTCCCCACTGCCTGCAGCCAGTGGCTTCTCGGGGAAAGGCTCCCCAAAGACACCCCTTCCCGGAAGC
T
CTCCGAGGGCCATTTTCCCAGTTTCGGTATGAACCTCCCCCAGGAGACCTAGATGGGTTCCCCGGGGTC
TTC
GAAGGAGCAGGGTCTAGGAAACGGAAGAGCATGCCCACAAAGATGCCCTATAACCACCCTGCAGAAG
AA
GTCACCCTCGCCCTCCACTCAGAGGAGAACAAAAACCACGGCCTTCCCAACCTCCCTTTGCTGTTCCC
G
CAGCCCCCGCGCCCCAAGTATGACTCTCAGATGATCGACCTGTGCAACGTGGGCTTCCAATTCTACCGC
AGC
CTGGAACACTTTGGGGGCAAGCCCGTCAAGCAGGAACCCATTAAGCCCAGCGCCGTGTGGCCCCAGC
CA
ACGCCCACTCCATTCCTGCCCACGCCCTACCCCTACTACCCCAAAGTCCACCCGGGCCTCATGTTCCC
C
TTCTTCGTGCCCTCGTCCTCGCCCTTCCCCTTCAGCCGGCACACCTTCCTGCCCAAGCAGCCCCCGGAA
CCT
CTGCTGCCCCGGAAAGCCGAGCCCCAGGAGAGCGAGGAGACCAAGCAGAAGGTGGAGAGGGTGGACG
TG
AACGTGCAGATCGATGACAGCTACTACGTGGACGTGGGCGGCTCGCAGAAGCGCTGGCAGTGCCCCAC
C
TGCGAGAAGTCCTACACCTCCAAGTACAACCTGGTCACCCACATCCTGGGCCACAGTGGGATCAAGCCG
CAC
GCGTGCACGCACTGCGGGAAGCTCTTCAAGCAGCTCAGCCACCTGCATACCCACATGCTGACCCACC
AG
GGCACGCGGCCCCACAAGTGCCAGGTGTGCCACAAGGCCTTCACCCAGACCAGCCACCTGAAGCGCCA
C
ATGATGCAGCACAGCGAGGTGAAGCCGCACAACTGCCGCGTGTGCGGCCGCGGCTTTGCCTACCCCAGC
GAG
CTCAAGGCCCACGAAGCCAAGCACGCCAGTGGGCGCGAGAACATCTGTGTGGAGTGCGGCCTCGACT
TC
CCCACCTTGGCCCAGCTGAAGAGACACCTCACCACGCACCGGGGCCCCATCCAGTACAACTGCTCCGA
G
TGCGACAAGACCTTCCAGTACCCGAGCCAGCTGCAGAACCACATGATGAAGCACAAGGACATCCGGCCC
TAC
ATCTGCTCAGAGTGTGGCATGGAGTTTGTGCAGCCGCACCACCTCAAGCAGCACTCCCTCACCCACA
AG
GGTGTGAAGGAGCATAAGTGTGGGATTTGTGGGCGGGAGTTCACCCTGCTGGCCAACATGAAGCGACA
C
GTGCTGATCCACACCAACATCCGCGCCTACCAGTGTCACCTCTGCTACAAGAGCTTCGTGCAGAAGCAG
ACC
CTCAAGGCACACATGATCGTCCACTCTGACGTGAAGCCTTTCAAATGCAAGCTTTGTGGGAAGGAAT
TC
AACCGGATGCACAACCTGATGGGCCACATGCACCTGCACTCAGACAGCAAACCCTTCAAGTGCCTCTA
T
TGCCCAAGCAAATTCACCCTGAAGGGGAACCTGACACGCCACATGAAAGTCAAGCATGGAGTCATGGAG
CGG
GGCCTTCATTCCCAAGGTCTGGGAAGGGGGAGAATCGCCCTGGCACAGACAGCCGGTGTCCTGAGGA
GT
CTGGAGCAGGAGGAGCCCTTTGACCTCTCTCAGAAGCGCCGGGCCAAGGTGCCGGTGTTCCAGTCAGA
C
GGGGAGAGTGCCCAGGGCAGCCACTGCCACGAGGAGGAAGAGGAGGATAACTGCTACGAGGTGGAGCCC
TAC
AGCCCTGGCCTGGCCCCCCAGAGCCAGCAGCTCTGCACACCCGAGGATCTGTCCACCAAGTCGGAGC
AC
GCCCCCGAGGTGCTGGAGGAAGCCTGCAAGGAGGAGAAGGAGGATGCATCCAAGGGAGAATGGGAGAA
G
AGGAGCAAGGGTGACCTTGGGGCAGAGGGCGGCCAGGAGAGAGACTGTGCCGGCAGAGATGAGTGTCTC
AGT
CTCAGGGCTTTTCAGAGTACCCGGCGGGGCCCCTCTTTTTCTGATTACTTATACTTCAAGCACAGAG
AT
GAGAGTTTGAAAGAATTACTGGAGAGGAAAATGGAAAAACAAGCAGTGCTTTTAGGTATCTAA


Translation (744 aa):
MQKEMKMIKDEDVHFDLAVKKTPSFPHCLQPVASRGKAPQRHPFPEALRGPFSQFRYEPPPGDLDGFPGV
F
EGAGSRKRKSMPTKMPYNHPAEEVTLALHSEENKNHGLPNLPLLFPQPPRPKYDSQMIDLCNVGFQFYR
S
LEHFGGKPVKQEPIKPSAVWPQPTPTPFLPTPYPYYPKVHPGLMFPFFVPSSSPFPFSRHTFLPKQPPE
P
LLPRKAEPQESEETKQKVERVDVNVQIDDSYYVDVGGSQKRWQCPTCEKSYTSKYNLVTHILGHSGIKP
H
ACTHCGKLFKQLSHLHTHMLTHQGTRPHKCQVCHKAFTQTSHLKRHMMQHSEVKPHNCRVCGRGFAYPS
E
LKAHEAKHASGRENICVECGLDFPTLAQLKRHLTTHRGPIQYNCSECDKTFQYPSQLQNHMMKHKDIRP
Y
ICSECGMEFVQPHHLKQHSLTHK
GVKEHKCGICGREFTLLANMKRHVLIHTNIRAYQCHLCYKSFVQKQ
T
LKAHMIVHSDVKPFKCK
LCGKEFNRMHNLMGHMHLHSDSKPFKCLYCPSKFTLKGNLTRHMKVKHGVME
R
GLHSQ
GLGRGRIALAQTAGVLRSLEQEEPFDLSQKRRAKVPVFQSDGESAQGSHCHEEEEEDNCYEVEP
Y
SPGLAPQSQQLCTPEDLSTKSEHAPEVLEEACKEEKEDASKGEWEKRSKGDLGAEGGQERDCAGRDECL
S
LRAFQSTRRGPSFSDYLYFKHRDESLKELLERKMEKQAVLLGI




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser