NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS6397.2 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
6397.2 Under review, update Homo sapiens 8 ZFP41 22 109 92 CCDS HistoryNCBI Gene:286128Re-query CCDS DB by CCDS ID:6397.2Re-query CCDS DB by GeneID:286128See the combined annotation on chromosome 8 in Sequence Viewer

Public Note for CCDS 6397.1
This CCDS ID represents the human ortholog of the mouse protein described in PMID: 1397691. This protein is encoded by two alternate splice variants supported by BC034608.1 and AK096024.1. It should be noted this transcript is predicted to undergo nonsense-mediated mRNA decay (NMD). The mouse transcript (CCDSID: 37108.1) is also a candidate for NMD. It is likely that the majority of transcripts representing this variant will undergo NMD, while some low level of NMD escape may allow for the expression of this protein.

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)


Attributes
CDS uses downstream AUG
Nonsense-mediated decay (NMD) candidate

Sequence IDs included in CCDS 6397.2

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000330701.5 ENSP00000327427.5 Accepted alive Link to Ensembl Transcript Viewer:ENST00000330701.5Link to Ensembl Protein Viewer:ENSP00000327427.5Re-query CCDS DB by Nucleotide ID:ENST00000330701Re-query CCDS DB by Protein ID:ENSP00000327427
Original member Current member EBI,WTSI ENST00000522452.1 ENSP00000428966.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000522452.1Link to Ensembl Protein Viewer:ENSP00000428966.2Re-query CCDS DB by Nucleotide ID:ENST00000522452Re-query CCDS DB by Protein ID:ENSP00000428966
Original member Current member EBI,WTSI ENST00000520584.5 ENSP00000430465.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000520584.5Link to Ensembl Protein Viewer:ENSP00000430465.2Re-query CCDS DB by Nucleotide ID:ENST00000520584Re-query CCDS DB by Protein ID:ENSP00000430465
Original member NCBI NM_001271156.2 NP_001258085.2 Updated not alive Link to Nucleotide Sequence:NM_001271156.2Link to Protein Sequence:NP_001258085.2Re-query CCDS DB by Nucleotide ID:NM_001271156Re-query CCDS DB by Protein ID:NP_001258085
Current member NCBI NM_001271156.3 NP_001258085.3 Pending alive Link to Nucleotide Sequence:NM_001271156.3Link to Protein Sequence:NP_001258085.3Re-query CCDS DB by Nucleotide ID:NM_001271156Re-query CCDS DB by Protein ID:NP_001258085Link to BLAST:NP_001258085.3
Original member NCBI NM_173832.5 NP_776193.2 Updated not alive Link to Nucleotide Sequence:NM_173832.5Link to Protein Sequence:NP_776193.2Re-query CCDS DB by Nucleotide ID:NM_173832Re-query CCDS DB by Protein ID:NP_776193
Current member NCBI NM_173832.6 NP_776193.3 Pending alive Link to Nucleotide Sequence:NM_173832.6Link to Protein Sequence:NP_776193.3Re-query CCDS DB by Nucleotide ID:NM_173832Re-query CCDS DB by Protein ID:NP_776193Link to BLAST:NP_776193.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001258085.3 198 Q8N8Y5 198 100% 0 0
NP_776193.3 198 Q8N8Y5 198 100% 0 0

Chromosomal Locations for CCDS 6397.2

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 8 (NC_000008.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 143249841 143250440 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (600 nt):
ATGATGGAGAAGCCTGCAGGCAGAAAAAAGAAGACGCCGACCCCAAGGGAGGAGGCAGACGTGCAGAAGA
GT
GCGCTCAGAGAGGAGAAGGTGTCCGGGGACAGAAAGCCACCTGAGAGGCCCACTGTGCCCAGGAAGCC
C
CGCACAGAGCCCTGCCTGAGTCCTGAAGACGAAGAGCACGTCTTTGATGCCTTCGACGCTTCATTTAAA
GAT
GACTTTGAGGGGGTTCCCGTGTTCATTCCTTTTCAGAGGAAGAAACCCTATGAGTGCAGTGAGTGTG
GG
CGGATCTTTAAGCACAAGACAGACCACATTCGCCATCAGAGGGTCCACACTGGAGAGAAGCCCTTCAA
G
TGTGCGCAGTGCGGGAAGGCCTTCCGGCACAGCTCTGACGTCACCAAACACCAGAGGACTCACACGGGA
GAG
AAGCCCTTCAAATGCGGGGAGTGCGGGAAAGCCTTTAACTGCGGCTCCAATCTCCTGAAACATCAGA
AG
ACGCACACCGGGGAGAAGCCCTACGAATGCACGCACTGTGGGAAAGCCTTTGCCTACAGCTCCTGTCT
C
ATCCGCCATCAGAAACGCCACCCTCGGAAGAAGCCCTGA


Translation (199 aa):
MMEKPAGRKKKTPTPREEADVQKSALREEKVSGDRKPPERPTVPRKPRTEPCLSPEDEEHVFDAFDASFK
D
DFEGVPVFIPFQRKKPYECSECGRIFKHKTDHIRHQRVHTGEKPFKCAQCGKAFRHSSDVTKHQRTHTG
E
KPFKCGECGKAFNCGSNLLKHQKTHTGEKPYECTHCGKAFAYSSCLIRHQKRHPRKKP




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser