NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS9827.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
9827.1 Public Homo sapiens 14 VSX2 22 109 92 CCDS HistoryNCBI Gene:338917Re-query CCDS DB by CCDS ID:9827.1Re-query CCDS DB by GeneID:338917See the combined annotation on chromosome 14 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 9827.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000261980.2 ENSP00000261980.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000261980.2Link to Ensembl Protein Viewer:ENSP00000261980.2Re-query CCDS DB by Nucleotide ID:ENST00000261980Re-query CCDS DB by Protein ID:ENSP00000261980
Original member Current member NCBI NM_182894.2 NP_878314.1 Accepted alive Link to Nucleotide Sequence:NM_182894.2Link to Protein Sequence:NP_878314.1Re-query CCDS DB by Nucleotide ID:NM_182894Re-query CCDS DB by Protein ID:NP_878314Link to BLAST:NP_878314.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_878314.1 361 P58304 361 100% 0 0

Chromosomal Locations for CCDS 9827.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 14 (NC_000014.9)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14See the combined annotation on chromosome 14 in Sequence Viewer

Chromosome Start Stop Links
14 74239562 74239931 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 74241182 74241266 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 74245165 74245288 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 74259602 74259782 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 74260594 74260919 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1086 nt):
ATGACGGGGAAAGCAGGGGAAGCGCTGAGCAAGCCCAAATCCGAGACAGTGGCCAAGAGTACCTCGGGGG
GC
GCCCCGGCCAGGTGCACTGGGTTCGGCATCCAGGAGATCCTGGGCTTGAACAAGGAGCCCCCGAGCTC
C
CACCCGCGGGCAGCGCTCGACGGCCTGGCCCCCGGGCACTTGCTGGCGGCGCGCTCAGTGCTCAGCCCC
GCG
GGGGTGGGCGGCATGGGGCTTCTGGGGCCCGGGGGGCTCCCTGGCTTCTACACGCAGCCCACCTTCC
TG
GAAGTGCTGTCCGACCCGCAGAGCGTCCACTTGCAGCCATTGGGCAGAGCATCGGGGCCGCTGGACAC
C
AGCCAGACGGCCAGCTCGGATTCTGAAGATGTTTCCTCCAGCGATCGAAAAATGTCCAAATCTGCTTTA
AAC
CAGACCAAGAAACGGAAGAAGCGGCGACACAGGACAATCTTTACCTCCTACCAGCTAGAGGAGCTGG
AG
AAGGCATTCAACGAAGCCCACTACCCAGACGTCTATGCCCGGGAGATGCTGGCCATGAAAACGGAGCT
G
CCGGAAGACAGGATACAGGTCTGGTTCCAGAACCGTCGAGCCAAGTGGAGGAAGCGGGAGAAGTGCTGG
GGC
CGGAGCAGTGTCATGGCGGAGTATGGGCTCTACGGGGCCATGGTGCGGCACTCCATCCCCCTGCCCG
AG
TCCATCCTCAAGTCAGCCAAGGATGGCATCATGGACTCCTGTGCCCCGTGGCTACTGGGGATGCACAA
A
AAGTCGCTGGAGGCAGCAGCCGAGTCGGGGAGGAAGCCCGAGGGGGAACGCCAGGCCCTGCCCAAGCTC
GAC
AAGATGGAGCAGGACGAGCGGGGCCCCGACGCTCAGGCGGCCATCTCCCAGGAGGAACTGAGGGAGA
AC
AGCATTGCGGTGCTCCGGGCCAAAGCTCAGGAGCACAGCACCAAAGTGCTGGGGACTGTGTCTGGGCC
G
GACAGCCTGGCCCGGAGTACCGAGAAGCCAGAGGAGGAGGAGGCCATGGATGAAGACAGGCCGGCGGAG
AGG
CTCAGTCCACCGCAGCTGGAGGACATGGCTTAG


Translation (361 aa):
MTGKAGEALSKPKSETVAKSTSGGAPARCTGFGIQEILGLNKEPPSSHPRAALDGLAPGHLLAARSVLSP
A
GVGGMGLLGPGGLPGFYTQPTFLEVLSDPQSVHLQPLGRASGPLDTSQTASS
DSEDVSSSDRKMSKSAL
N
QTKKRKKRRH
RTIFTSYQLEELEKAFNEAHYPDVYAREMLAMKTELPEDRIQVWFQNRRAKWRKREKCW
G
RSSVMAEYGLYGAMVRHSIPLPESILKSAKDGIMDSCAPWLL
GMHKKSLEAAAESGRKPEGERQALPKL
D
KMEQDERGPDAQAAISQEELRENSIAVLRAKAQEHSTKVLGTVSGPDSLARSTEKPEEEEAMDEDRPAE
R
LSPPQLEDMA




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser