NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS42628.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
42628.1 Public Homo sapiens 19 TNNI3 20 108 85 CCDS HistoryNCBI Gene:7137Re-query CCDS DB by CCDS ID:42628.1Re-query CCDS DB by GeneID:7137See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 5, NCBI annotation release 36.3, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 42628.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000344887 ENSP00000341838 Accepted alive Link to Ensembl Transcript Viewer:ENST00000344887Link to Ensembl Protein Viewer:ENSP00000341838Re-query CCDS DB by Nucleotide ID:ENST00000344887Re-query CCDS DB by Protein ID:ENSP00000341838
Original member Current member EBI,WTSI OTTHUMT00000452098 OTTHUMP00000264736 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000452098Link to Vega Protein Viewer:OTTHUMP00000264736Re-query CCDS DB by Nucleotide ID:OTTHUMT00000452098Re-query CCDS DB by Protein ID:OTTHUMP00000264736
Original member Current member NCBI NM_000363.4 NP_000354.4 Accepted alive Link to Nucleotide Sequence:NM_000363.4Link to Protein Sequence:NP_000354.4Re-query CCDS DB by Nucleotide ID:NM_000363Re-query CCDS DB by Protein ID:NP_000354Link to BLAST:NP_000354.4

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000354.4 210 P19429 210 100% 0 0

Chromosomal Locations for CCDS 42628.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '-' strand of Chromosome 19 (NC_000019.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 55151834 55151917 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 55154030 55154206 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 55154741 55154830 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 55156201 55156332 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 55156603 55156644 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 55157050 55157133 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 55157296 55157308 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 55157579 55157589 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (633 nt):
ATGGCGGATGGGAGCAGCGATGCGGCTAGGGAACCTCGCCCTGCACCAGCCCCAATCAGACGCCGCTCCT
CC
AACTACCGCGCTTATGCCACGGAGCCGCACGCCAAGAAAAAATCTAAGATCTCCGCCTCGAGAAAATT
G
CAGCTGAAGACTCTGCTGCTGCAGATTGCAAAGCAAGAGCTGGAGCGAGAGGCGGAGGAGCGGCGCGGA
GAG
AAGGGGCGCGCTCTGAGCACCCGCTGCCAGCCGCTGGAGTTGGCCGGGCTGGGCTTCGCGGAGCTGC
AG
GACTTGTGCCGACAGCTCCACGCCCGTGTGGACAAGGTGGATGAAGAGAGATACGACATAGAGGCAAA
A
GTCACCAAGAACATCACGGAGATTGCAGATCTGACTCAGAAGATCTTTGACCTTCGAGGCAAGTTTAAG
CGG
CCCACCCTGCGGAGAGTGAGGATCTCTGCAGATGCCATGATGCAGGCGCTGCTGGGGGCCCGGGCTA
AG
GAGTCCCTGGACCTGCGGGCCCACCTCAAGCAGGTGAAGAAGGAGGACACCGAGAAGGAAAACCGGGA
G
GTGGGAGACTGGCGCAAGAACATCGATGCACTGAGTGGAATGGAGGGCCGCAAGAAAAAGTTTGAGAGC
TGA


Translation (210 aa):
MADGSSDAAREPRPAPAPIRRRSSNYRAYATEPHAKKKSKISASRKLQLKTLLLQIAKQELEREAEERRG
E
KGRALSTRCQPLELAGLGFAELQ
DLCRQLHARVDKVDEERYDIEAKVTKNITEIADLTQKIFDLRGKFK
R
PTLRRVRISADAMMQALLGARAKESLDLRAHLKQVKKEDTEK
ENREVGDWRKNIDALSGMEGRKKKFES



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser