NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS11342.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
11342.1 Public Homo sapiens 17 TCAP 20 108 85 CCDS HistoryNCBI Gene:8557Re-query CCDS DB by CCDS ID:11342.1Re-query CCDS DB by GeneID:8557See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 11342.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000309889 ENSP00000312624 Accepted alive Link to Ensembl Transcript Viewer:ENST00000309889Link to Ensembl Protein Viewer:ENSP00000312624Re-query CCDS DB by Nucleotide ID:ENST00000309889Re-query CCDS DB by Protein ID:ENSP00000312624
Original member Current member EBI,WTSI OTTHUMT00000256942 OTTHUMP00000164283 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000256942Link to Vega Protein Viewer:OTTHUMP00000164283Re-query CCDS DB by Nucleotide ID:OTTHUMT00000256942Re-query CCDS DB by Protein ID:OTTHUMP00000164283
Original member Current member NCBI NM_003673.3 NP_003664.1 Accepted alive Link to Nucleotide Sequence:NM_003673.3Link to Protein Sequence:NP_003664.1Re-query CCDS DB by Nucleotide ID:NM_003673Re-query CCDS DB by Protein ID:NP_003664Link to BLink:NP_003664.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_003664.1 167 O15273 167 100% 0 0

Chromosomal Locations for CCDS 11342.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '+' strand of Chromosome 17 (NC_000017.11)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 17Link to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 39665360 39665469 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 39665716 39666109 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (504 nt):
ATGGCTACCTCAGAGCTGAGCTGCGAGGTGTCGGAGGAGAACTGTGAGCGCCGGGAGGCCTTCTGGGCAG
AA
TGGAAGGATCTGACACTGTCCACACGGCCCGAGGAGGGCTGCTCCCTGCATGAGGAGGACACCCAGAG
A
CATGAGACCTACCACCAGCAGGGGCAGTGCCAGGTGCTGGTGCAGCGCTCGCCCTGGCTGATGATGCGG
ATG
GGCATCCTCGGCCGTGGGCTGCAGGAGTACCAGCTGCCCTACCAGCGGGTACTGCCGCTGCCCATCT
TC
ACCCCTGCCAAGATGGGCGCCACCAAGGAGGAGCGTGAGGACACCCCCATCCAGCTTCAGGAGCTGCT
G
GCGCTGGAGACAGCCCTGGGTGGCCAGTGTGTGGACCGCCAGGAGGTGGCTGAGATCACAAAGCAGCTG
CCC
CCTGTGGTGCCTGTCAGCAAGCCCGGTGCACTTCGTCGCTCCCTGTCCCGCTCCATGTCCCAGGAAG
CA
CAGAGAGGCTGA


Translation (167 aa):
MATSELSCEVSEENCERREAFWAEWKDLTLSTRPEEGCSLHEEDTQRHETYHQQGQCQVLVQRSPWLMMR
M
GILGRGLQEYQLPYQRVLPLPIFTPAKMGATKEEREDTPIQLQELLALETALGGQCVDRQEVAEITKQL
P
PVVPVSKPGALRRSLSRSMSQEAQRG




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser