NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS47658.2 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
47658.2 Public Homo sapiens 7 SPDYE3 22 109 92 CCDS HistoryNCBI Gene:441272Re-query CCDS DB by CCDS ID:47658.2Re-query CCDS DB by GeneID:441272See the combined annotation on chromosome 7 in Sequence Viewer

Public Note for CCDS 47658.1
The coding region has been updated to represent an alternative splicing pattern, resulting in an extended N-terminus that is better supported by the available transcript data.

Public since: CCDS release 6, NCBI annotation release 37.1, Ensembl annotation release 55

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)

Sequence IDs included in CCDS 47658.2

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000332397.6 ENSP00000329565.6 Accepted alive Link to Ensembl Transcript Viewer:ENST00000332397.6Link to Ensembl Protein Viewer:ENSP00000329565.6Re-query CCDS DB by Nucleotide ID:ENST00000332397Re-query CCDS DB by Protein ID:ENSP00000329565
Original member Current member NCBI NM_001004351.4 NP_001004351.3 Accepted alive Link to Nucleotide Sequence:NM_001004351.4Link to Protein Sequence:NP_001004351.3Re-query CCDS DB by Nucleotide ID:NM_001004351Re-query CCDS DB by Protein ID:NP_001004351Link to BLAST:NP_001004351.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001004351.3 549 A6NKU9-1 549 100% 0 0

Chromosomal Locations for CCDS 47658.2

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 7 (NC_000007.14)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 100307886 100307991 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 100308974 100309192 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 100310360 100310578 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 100311750 100311968 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 100313140 100313358 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 100314532 100314750 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 100315785 100315843 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 100317070 100317155 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 100319565 100319808 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 100319931 100319990 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1650 nt):
ATGACGAGCCATCAACCGCAGCCCCAGGAAGAGCAGAGCCCCCAGCGGAGCACCTCAGGGTACCCCCTCC
AG
GAGGTGGTGGATGATGAAGTGTCGGGACCATCAGCCCCTGGGGTAGATCCCAGCCCCCCACGTAGGTC
C
CTTGGCTGCAAAAGGAAGAGGGAGTGTTTGGATGAATCTGATGATGAGCCAGAGAAGGAGCTCGCCCCT
GAG
CCTGAGGAGACCTGGGTGGCGGAGACGCTGTGTGGCCTCAAGATGAAGGCGAAGCGACGGCGAGTGT
CG
CTCGTGCTCCCTGAGTACTACGAGGCCTTCAACAGGCTGCTTGCCCCTGGGGTAGATCCCAGCCCCCC
A
CGTAGGTCCCTTGGCTGCAAAAGGAAGAGGGAGTGTTTGGATGAATCTGATGATGAGCCAGAGAAGGAG
CTC
GCCCCTGAGCCTGAGGAGACCTGGGTGGCGGAGACGCTGTGTGGCCTCAAGATGAAGGCGAAGCGAC
GG
CGAGTGTCGCTCGTGCTCCCTGAGTACTACGAGGCCTTCAACAGGCTGCTTGCCCCTGGGGTAGATCC
C
AGCCCCCCACGTAGGTCCCTTGGCTGCAAAAGGAAGAGGGAGTGTTTGGATGAATCTGATGATGAGCCA
GAG
AAGGAGCTCGCCCCTGAGCCTGAGGAGACCTGGGTGGCAGAGACGCTGTGTGGCCTCAAGATGAAGG
CG
AAGCGACGGCGAGTGTCGCTCGTGCTCCCTGAGTACTACGAGGCCTTCAACAGGCTGCTTGCCCCTGG
G
GTAGATCCCAGCCCCCCACGTAGGTCCCTTGGCTGCAAAAGGAAGAGGGAGTGTTTGGATGAATCTGAT
GAT
GAGCCAGAGAAGGAGCTCGCCCCTGAGCCTGAGGAGACCTGGGTGGCGGAGACGCTGTGTGGCCTCA
AG
ATGAAGGCGAAGCGACGGCGAGTGTCGCTCGTGCTCCCTGAGTACTACGAGGCCTTCAACAGGCTGCT
T
GCCCCTGGGGTAGATCCCAGCCCCCCGCGTAGGTCCCTTGGCTGCAAAAGGAAGAGGGAGTGTTTGGAT
GAA
TCTGATGATGAGCCAGAGAAGGAGCTCGCCCCTGAGCCTGAGGAGACCTGGGTGGCGGAGACGCTGT
GT
GGCCTCAAGATGAAGGCGAAGCGACGGCGAGTGTCGCTCGTGCTCCCTGAGTACTACGAGGCCTTCAA
C
AGGCTGCTTGAGGATCCTGTCATTAAAAGATTCCTGGCCTGGGACAAAGATCTGAGGGTGTCAGACAAG
TAT
CTCCTGGCTATGGTCATAGCGTATTTCAGCCGGGCCGGCCTCCCCTCCTGGCAATACCAACGCATTC
AT
TTCTTCCTGGCTCTCTATCTGGCCAATGACATGGAGGAGGACGACGAGGCCCCCAAACAAAAGATCTT
C
TACTTCCTGTACGGGAAGACCCACTCTCACATACCCTTGCGCCCTAAGCATTGGTTCCAGTTATGCCGT
CCC
ATGAACCCGAGGGCCAGGAAGAACTGCTCTCAGATAGCCTTGTTCCAGAAGCGTCGGTTCCAGTTCT
TC
TGTTCCATGCGCTGCAGGGCTTGGGTTTCCCCGGAGGAGTTGGAGGAGATCCAGGCTTATGACCCAGA
G
CACTGGGTGTGGGCGCGAGATCGCGCCCACCTTTCCTAG


Translation (549 aa):
MTSHQPQPQEEQSPQRSTSGYPLQEVVDDEVSGPSAPGVDPSPPRRSLGCKRKRECLDESDDEPEKELAP
E
PEETWVAETLCGLKMKAKRRRVSLVLPEYYEAFNRLL
APGVDPSPPRRSLGCKRKRECLDESDDEPEKE
L
APEPEETWVAETLCGLKMKAKRRRVSLVLPEYYEAFNRLL
APGVDPSPPRRSLGCKRKRECLDESDDEP
E
KELAPEPEETWVAETLCGLKMKAKRRRVSLVLPEYYEAFNRLL
APGVDPSPPRRSLGCKRKRECLDESD
D
EPEKELAPEPEETWVAETLCGLKMKAKRRRVSLVLPEYYEAFNRLL
APGVDPSPPRRSLGCKRKRECLD
E
SDDEPEKELAPEPEETWVAETLCGLKMKAKRRRVSLVLPEYYEAFNRLL
EDPVIKRFLAWDKDLRVSDK
Y
LLAMVIAYFSRAGLPSWQYQRIHFFLA
LYLANDMEEDDEAPKQKIFYFLYGKTHSHIPLRPKHWFQLCR
P
MNPRARKNCSQIALFQKRRFQFFCSMRCRAWVSPEELEE
IQAYDPEHWVWARDRAHLS



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser