NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS83379.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
83379.1 Public Homo sapiens 9 SPATA31D4 22 109 92 CCDS HistoryNCBI Gene:389761Re-query CCDS DB by CCDS ID:83379.1Re-query CCDS DB by GeneID:389761See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 20, NCBI annotation release 108, Ensembl annotation release 85

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 83379.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000419782.4 ENSP00000488251.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000419782.4Link to Ensembl Protein Viewer:ENSP00000488251.1Re-query CCDS DB by Nucleotide ID:ENST00000419782Re-query CCDS DB by Protein ID:ENSP00000488251
Original member Current member NCBI NM_001145197.1 NP_001138669.1 Accepted alive Link to Nucleotide Sequence:NM_001145197.1Link to Protein Sequence:NP_001138669.1Re-query CCDS DB by Nucleotide ID:NM_001145197Re-query CCDS DB by Protein ID:NP_001138669Link to BLAST:NP_001138669.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001138669.1 917 Q6ZUB0 917 100% 0 0

Chromosomal Locations for CCDS 83379.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 9 (NC_000009.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 81928514 81928699 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 81929456 81929501 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 81930100 81930160 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 81930455 81932915 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2754 nt):
ATGGAGAATATCCTCTGTTTTCTGAACAGCTATACTGAGACAGGGCTGAGCCCTGACTCACATTGTTTGG
AT
ATTGACCTCAACTTCATCTGCTTGAGTGGGTTGGGGTTGTTTATACTGTACTTGTTCTACATGGTATT
G
ACCCTGTATTCATCACCCACCGAAAAAAATAATGACACCCAAAAGCATCAGGGCAGAGCCAGGAGGAAA
AGA
AAAAGCGTGACATTTAAAGACCGGAAAAGTTTGCAGAAGGAAGCAGAAGAGGAAAGAAAGCTACATT
CT
TTTCTGAAAAGCTTTGGACCTCCTGTTTCCTGCAGTCCCCTGGGCCAGCATCATGATACCACCCTCTT
T
CGTCGACTGTTATGCCCAGACCCTGTCTGTCGGGTGTGTAACAGAGCAACTGCTGATATCCAGCGACTG
CTG
TCTTGGGAGTCCCTGAAAGATGCTGCTCCCTCTGTGTCCCCTTTGGCTTCTTCAGCTTCTGGGGCTG
AG
TCATCGTTCACTCTGGCTTCCACCCCCTCAGCAACCACTCCAGAAGACCTAATATTGTCCTCTCGGCC
T
AAGCCCTCTCCACCACCCCCCTTAATTCTCTCACCTGACCTGATCACCACCTTAGCTGACTTATTTTCA
CCC
TCACCACTGAGGGACCCTCTGCCACCACAGCCTGTTTCTCCCTTGGATTCCAAGTTCCCCATAGACC
AT
TCCCCACCCCAACAGCTTCCCTTTCCCCTTCTCCCACCACATCACATTGAGAGAGTGGAGCCCAGCCT
C
CAACCTGAGGCCAGTTTGTCTCTGAACACCATCTTTTCATTTGGCTCCACCCTATGCCAAGATATTTCC
CAG
GCCGTGAATCGCACTGATTCATGTGCTCGTCATCATGGACCACCAACCCCATCTGCTTTACCACCGG
AA
GATTGCACTGTGACTCAGTCTAAATCAAATCTCACCGTCTTGAAGACTTTTCCGGAAATGTTATCTCT
A
GGTGGCTCTGGTGGGTCATCCACCTCTGCCCCAACAACGAAAGGCATTGACCATTCATGCCCTGCATCT
TCA
GAATTCTCCTGGTGGCAGCCTCATGCCAAGGACTCTTTTTCCTCTAATTTTGTGCCATCTGATTTCA
TG
GAGGAGCTTCTTACCCTTCATTCTTCTGAGGCCTCTTTAGGGGGGCACTCTGTGGCCAACATCATACA
G
CCTGTTAACATCTCTTTTCTCAGCCATGACATTCCGGCACTCCTGGAGAGACAAGTCAAAAGAAGGGGT
GAT
TTCCTGATGTGGAAAGAAAATGGAAAGAAACCAGGATCATTCCCAACACAACTTAGGCCAAACTACC
AA
CTAAATTCCTCACGGAATATGTTAACCTCAACTGCTGTTAAGCATGACTTAGCAGAATCCTTTCCTTT
T
TGGGCCAGTAAAGGCAAACTAGAGTGGCAGCACATCCATCAGCAGCCCCCATATTCTAAGTGTTTTGAG
GAC
CATTTAGAGCAAAAATATGTCCAGCTCTTCTGGGGTCTCCCATCTTTGCACAGCGAGTCTCTGCATC
CT
ACTGTTTTTGTCCAACATGGCCGTTCCTCCATGTTTGTATTCTTCAATGGCATTACAAATACATCTAT
G
TCCCATGAATCCCCAGTACTTCCCCCTCCCCAACCTCTGTTCTTGCCTAGTACCCAACCTCTACCCTTG
CCT
CAAACCCTGCCCCGAGGTCAGTCCCTACATCTCACTCAGGTGAAGTCCCTGGCTCAACCTCAATCTC
CA
TTCCCAGCCCTACCACCTAGTCCTCTATTCCTGATTAGGGTGTGTGGCGTGTGTTTTCATAGACCCCA
G
AATGAGGCACGGTCTCTTATGCCATCTGAAATTAATCATCTGGAGTGGAACGTGTTGCAGAAAGTGCAG
GAA
AGTGTGTGGGGTTTACCCTCTGTGGTTCAAAAATCCCAGGAAGACTTTTGTCCTCCAGCTCCCAATC
CT
GTATTGGTCAGAAAGTCCTTCAAGGTCCATGTTCCCATCTCCATCATTCCTGGAGATTTTCCACTCAG
C
TCTGAGGTAAGGAAGAAACTAGAGCAACACATTCGAAAGAGGCTCATCCAGCGCAGATGGGGCCTGCCC
CGC
AGAATCCATGAGTCTCTGTCATTGCTACGTCCTCAGAACAAAATTTCAGAGCTATCTGTGTCAGAGA
GC
ATTCATGGTCCATTAAATATCTCTTTGGTTGAGGGTCAGAGGTGCAATGTTCTAAAGAAGTCCGCATC
A
AGCTTCCCTAGAAGCTTCCACGAGAGGAGCTCAAATATGCTTTCCATGGAGAATGTGGGGAATTATCAG
GGA
TGCAGCCAGGAGACTGCCCCAAAAAACCATCTCTTGCATGATCCGGAGACATCTTCAGACGAGGATC
TG
AGGTCTAACTCTGAGAGAGACCTAGGAACTCATATGATGCATCTGTCAGGGAATGATTCAGGGGTGAG
A
CTAGGTCAGAAACAACTTGAAAATGCCCTGACAGTACATTTGAGCAAGAAATTTGAGGAAATCAATGAG
GGT
CGAATGCCTGGGACTGTGCATAGTTCATGGCACTCAGTCAAGCAGACAATATGTCTTCCTGAGAAAT
CC
CACAGCCAAATTAAACATCGAAATTTGGCAGCATTGGTGAGTGAGGACCACGGCGTTGATACCTCCCA
G
GAGATGTCCTTCCTTAGTTCCAACAAACAAAAGATGTTGGAAGCCCATATTAAATCTTTCCATATGAAG
CCC
ATATTAAATCTTTCCATATGA


Translation (917 aa):
MENILCFLNSYTETGLSPDSHCLDIDLNFICLSGLGLFILYLFYMVLTLYSSPTEKNNDTQKHQGRARRK
R
KSVTFK
DRKSLQKEAEEERKLHSFLKSFGPPVSCSPLGQHHDTTLFRRLLCPDPVCRVCNRATADIQRL
L
SWESLKDAAPSVSPLASSASGAESSFTLASTPSATTPEDLILSSRPKPSPPPPLILSPDLITTLADLFS
P
SPLRDPLPPQPVSPLDSKFPIDHSPPQQLPFPLLPPHHIERVEPSLQPEASLSLNTIFSFGSTLCQDIS
Q
AVNRTDSCARHHGPPTPSALPPEDCTVTQSKSNLTVLKTFPEMLSLGGSGGSSTSAPTTKGIDHSCPAS
S
EFSWWQPHAKDSFSSNFVPSDFMEELLTLHSSEASLGGHSVANIIQPVNISFLSHDIPALLERQVKRRG
D
FLMWKENGKKPGSFPTQLRPNYQLNSSRNMLTSTAVKHDLAESFPFWASKGKLEWQHIHQQPPYSKCFE
D
HLEQKYVQLFWGLPSLHSESLHPTVFVQHGRSSMFVFFNGITNTSMSHESPVLPPPQPLFLPSTQPLPL
P
QTLPRGQSLHLTQVKSLAQPQSPFPALPPSPLFLIRVCGVCFHRPQNEARSLMPSEINHLEWNVLQKVQ
E
SVWGLPSVVQKSQEDFCPPAPNPVLVRKSFKVHVPISIIPGDFPLSSEVRKKLEQHIRKRLIQRRWGLP
R
RIHESLSLLRPQNKISELSVSESIHGPLNISLVEGQRCNVLKKSASSFPRSFHERSSNMLSMENVGNYQ
G
CSQETAPKNHLLHDPETSSDEDLRSNSERDLGTHMMHLSGNDSGVRLGQKQLENALTVHLSKKFEEINE
G
RMPGTVHSSWHSVKQTICLPEKSHSQIKHRNLAALVSEDHGVDTSQEMSFLSSNKQKMLEAHIKSFHMK
P
ILNLSI




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser