NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS8685.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
8685.1 Public Homo sapiens 12 SLCO1B1 20 108 85 CCDS HistoryNCBI Gene:10599Re-query CCDS DB by CCDS ID:8685.1Re-query CCDS DB by GeneID:10599See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 8685.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000256958 ENSP00000256958 Accepted alive Link to Ensembl Transcript Viewer:ENST00000256958Link to Ensembl Protein Viewer:ENSP00000256958Re-query CCDS DB by Nucleotide ID:ENST00000256958Re-query CCDS DB by Protein ID:ENSP00000256958
Original member Current member EBI,WTSI OTTHUMT00000402070 OTTHUMP00000239999 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000402070Link to Vega Protein Viewer:OTTHUMP00000239999Re-query CCDS DB by Nucleotide ID:OTTHUMT00000402070Re-query CCDS DB by Protein ID:OTTHUMP00000239999
Original member Current member NCBI NM_006446.4 NP_006437.3 Accepted alive Link to Nucleotide Sequence:NM_006446.4Link to Protein Sequence:NP_006437.3Re-query CCDS DB by Nucleotide ID:NM_006446Re-query CCDS DB by Protein ID:NP_006437Link to BLink:NP_006437.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_006437.3 691 Q9Y6L6 691 100% 0 0

Chromosomal Locations for CCDS 8685.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '+' strand of Chromosome 12 (NC_000012.12)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 12Link to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 21141575 21141658 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 21172650 21172791 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 21174577 21174709 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 21176776 21176897 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 21178576 21178722 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 21178922 21179020 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 21196946 21197188 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 21200508 21200672 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 21202491 21202686 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 21205868 21206033 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 21217119 21217303 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 21222300 21222364 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 21224722 21224839 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 21238979 21239189 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2076 nt):
ATGGACCAAAATCAACATTTGAATAAAACAGCAGAGGCACAACCTTCAGAGAATAAGAAAACAAGATACT
GC
AATGGATTGAAGATGTTCTTGGCAGCTCTGTCACTCAGCTTTATTGCTAAGACACTAGGTGCAATTAT
T
ATGAAAAGTTCCATCATTCATATAGAACGGAGATTTGAGATATCCTCTTCTCTTGTTGGTTTTATTGAC
GGA
AGCTTTGAAATTGGAAATTTGCTTGTGATTGTATTTGTGAGTTACTTTGGATCCAAACTACATAGAC
CA
AAGTTAATTGGAATCGGTTGTTTCATTATGGGAATTGGAGGTGTTTTGACTGCTTTGCCACATTTCTT
C
ATGGGATATTACAGGTATTCTAAAGAAACTAATATCAATTCATCAGAAAATTCAACATCGACCTTATCC
ACT
TGTTTAATTAATCAAATTTTATCACTCAATAGAGCATCACCTGAGATAGTGGGAAAAGGTTGTTTAA
AG
GAATCTGGGTCATACATGTGGATATATGTGTTCATGGGTAATATGCTTCGTGGAATAGGGGAGACTCC
C
ATAGTACCATTGGGGCTTTCTTACATTGATGATTTCGCTAAAGAAGGACATTCTTCTTTGTATTTAGGT
ATA
TTGAATGCAATAGCAATGATTGGTCCAATCATTGGCTTTACCCTGGGATCTCTGTTTTCTAAAATGT
AC
GTGGATATTGGATATGTAGATCTAAGCACTATCAGGATAACTCCTACTGATTCTCGATGGGTTGGAGC
T
TGGTGGCTTAATTTCCTTGTGTCTGGACTATTCTCCATTATTTCTTCCATACCATTCTTTTTCTTGCCC
CAA
ACTCCAAATAAACCACAAAAAGAAAGAAAAGCTTCACTGTCTTTGCATGTGCTGGAAACAAATGATG
AA
AAGGATCAAACAGCTAATTTGACCAATCAAGGAAAAAATATTACCAAAAATGTGACTGGTTTTTTCCA
G
TCTTTTAAAAGCATCCTTACTAATCCCCTGTATGTTATGTTTGTGCTTTTGACGTTGTTACAAGTAAGC
AGC
TATATTGGTGCTTTTACTTATGTCTTCAAATACGTAGAGCAACAGTATGGTCAGCCTTCATCTAAGG
CT
AACATCTTATTGGGAGTCATAACCATACCTATTTTTGCAAGTGGAATGTTTTTAGGAGGATATATCAT
T
AAAAAATTCAAACTGAACACCGTTGGAATTGCCAAATTCTCATGTTTTACTGCTGTGATGTCATTGTCC
TTT
TACCTATTATATTTTTTCATACTCTGTGAAAACAAATCAGTTGCCGGACTAACCATGACCTATGATG
G
A
AATAATCCAGTGACATCTCATAGAGATGTACCACTTTCTTATTGCAACTCAGACTGCAATTGTGATGA
A
AGTCAATGGGAACCAGTCTGTGGAAACAATGGAATAACTTACATCTCACCCTGTCTAGCAGGTTGCAAA
TCT
TCAAGTGGCAATAAAAAGCCTATAGTGTTTTACAACTGCAGTTGTTTGGAAGTAACTGGTCTCCAGA
AC
AGAAATTACTCAGCCCATTTGGGTGAATGCCCAAGAGATGATGCTTGTACAAGGAAATTTTACTTTTT
T
GTTGCAATACAAGTCTTGAATTTATTTTTCTCTGCACTTGGAGGCACCTCACATGTCATGCTGATTGTT
AA
A
ATTGTTCAACCTGAATTGAAATCACTTGCACTGGGTTTCCACTCAATGGTTATACGAGCACTAGGAG
GA
ATTCTAGCTCCAATATATTTTGGGGCTCTGATTGATACAACGTGTATAAAGTGGTCCACCAACAACTG
T
GGCACACGTGGGTCATGTAGGACATATAATTCCACATCATTTTCAAGGGTCTACTTGGGCTTGTCTTCA
ATG
TTAAGAGTCTCATCACTTGTTTTATATATTATATTAATTTATGCCATGAAGAAAAAATATCAAGAGA
AA
GATATCAATGCATCAGAAAATGGAAGTGTCATGGATGAAGCAAACTTAGAATCCTTAAATAAAAATAA
A
CATTTTGTCCCTTCTGCTGGGGCAGATAGTGAAACACATTGTTAA


Translation (691 aa):
MDQNQHLNKTAEAQPSENKKTRYCNGLKMFLAALSLSFIAKTLGAIIMKSSIIHIERRFEISSSLVGFID
G
SFEI
GNLLVIVFVSYFGSKLHRPKLIGIGCFIMGIGGVLTALPHFFMGYYRYSKETNINSSENSTSTLS
T
CLINQILSLNRASPEIVGK
GCLKESGSYMWIYVFMGNMLRGIGETPIVPLGLSYIDDFAKEGHSSLYLG
I
LNAIAMIGPIIGFTLGSLFSKMYVDIGYVDL
STIRITPTDSRWVGAWWLNFLVSGLFSIISSIPFFFLP
Q
TPNKPQKERKASLSLHVLETNDEKDQTANLTNQGKNITKNVT
GFFQSFKSILTNPLYVMFVLLTLLQVS
S
YIGAFTYVFKYVEQQYGQPSSKANILL
GVITIPIFASGMFLGGYIIKKFKLNTVGIAKFSCFTAVMSLS
F
YLLYFFILCENKSVAGLTMTYD
GNNPVTSHRDVPLSYCNSDCNCDESQWEPVCGNNGITYISPCLAGCK
S
SSGNKKPI
VFYNCSCLEVTGLQNRNYSAHLGECPRDDACTRKFYFFVAIQVLNLFFSALGGTSHVMLIV
K
IVQPELKSLALGFHSMVIRALGGILAPIYFGALIDTTCIKWSTNNCGTRGSCRTYNSTSFSRVYLGLSS
M
LRVSSLVLYIILIYAMKKKYQEKDINASENGSVMDEANLESLNKNKHFVPSAGADSETHC




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser