NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS6786.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
6786.1 Public Homo sapiens 9 SLC46A2 22 109 92 CCDS HistoryNCBI Gene:57864Re-query CCDS DB by CCDS ID:6786.1Re-query CCDS DB by GeneID:57864See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 6786.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000374228.4 ENSP00000363345.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000374228.4Link to Ensembl Protein Viewer:ENSP00000363345.4Re-query CCDS DB by Nucleotide ID:ENST00000374228Re-query CCDS DB by Protein ID:ENSP00000363345
Original member NCBI NM_033051.3 NP_149040.3 Updated not alive Link to Nucleotide Sequence:NM_033051.3Link to Protein Sequence:NP_149040.3Re-query CCDS DB by Nucleotide ID:NM_033051Re-query CCDS DB by Protein ID:NP_149040
Current member NCBI NM_033051.4 NP_149040.3 Accepted alive Link to Nucleotide Sequence:NM_033051.4Link to Protein Sequence:NP_149040.3Re-query CCDS DB by Nucleotide ID:NM_033051Re-query CCDS DB by Protein ID:NP_149040Link to BLAST:NP_149040.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_149040.3 475 Q9BY10 475 100% 0 0

Chromosomal Locations for CCDS 6786.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 9 (NC_000009.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 112879762 112879819 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 112886460 112886616 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 112887330 112887413 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 112889553 112890681 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1428 nt):
ATGAGCCCCGAGGTCACCTGCCCGCGGAGGGGCCACCTGCCTCGCTTCCACCCGAGGACCTGGGTTGAGC
CC
GTGGTGGCCTCGTCCCAGGTGGCTGCCTCCCTCTACGATGCGGGGCTACTCCTCGTGGTGAAGGCGTC
C
TACGGAACCGGAGGCTCCTCCAACCACAGTGCCAGCCCATCGCCCCGGGGGGCTCTAGAGGACCAACAG
CAG
AGAGCCATCTCCAATTTCTACATTATCTACAACCTTGTGGTGGGCCTGTCCCCCCTGCTGTCCGCCT
AC
GGGCTGGGATGGCTCAGCGACCGCTACCACCGAAAGATCTCCATCTGCATGTCGCTGCTGGGCTTCCT
G
CTCTCCCGCCTCGGGCTGCTGCTCAAGGTGCTGCTGGACTGGCCAGTGGAGGTGCTGTACGGGGCGGCG
GCG
CTGAACGGGCTATTCGGCGGCTTCTCCGCCTTCTGGTCCGGGGTCATGGCGCTGGGATCGCTGGGCT
CC
TCCGAGGGCCGCCGCTCTGTGCGCCTCATCCTCATTGACCTGATGCTGGGCTTGGCGGGGTTCTGCGG
G
AGCATGGCTTCCGGGCATCTCTTCAAGCAGATGGCTGGGCACTCTGGGCAGGGCCTGATACTGACGGCC
TGC
AGCGTGAGCTGTGCCTCGTTTGCCCTGCTCTACAGCCTTTTGGTGCTAAAGGTCCCTGAGTCGGTGG
CC
AAACCCAGCCAGGAGCTCCCCGCCGTGGATACCGTGTCTGGCACGGTTGGCACATACCGCACTCTGGA
T
CCTGATCAGTTGGACCAACAGTATGCAGTGGGGCACCCTCCATCTCCTGGAAAAGCAAAACCCCATAAA
ACC
ACCATTGCCTTGCTCTTTGTGGGTGCTATCATATATGACCTGGCGGTGGTGGGCACAGTGGACGTGA
TC
CCTCTTTTTGTGCTGAGGGAGCCTCTCGGTTGGAACCAAGTGCAGGTGGGCTATGGTATGGCTGCAGG
G
TACACCATCTTCATCACCAGCTTCCTGGGTGTCCTGGTCTTCTCCCGCTGCTTTCGGGACACCACCATG
ATC
ATGATTGGGATGGTCTCCTTTGGGTCAGGAGCCCTCCTCTTGGCTTTTGTGAAAGAGACATACATGT
TC
TATATTGCTCGAGCCGTCATGCTGTTTGCTCTCATCCCCGTCACAACCATCCGATCAGCTATGTCCAA
A
CTCATAAAGGGCTCCTCTTATGGAAAGGTGTTCGTCATACTGCAGCTGTCCTTGGCTCTGACCGGCGTG
GTG
ACATCCACCTTGTACAACAAGATCTACCAGCTCACCATGGACATGTTTGTGGGCTCCTGCTTTGCTC
TC
TCCTCCTTTCTCTCCTTCCTGGCCATCATTCCAATTAGCATCGTGGCCTATAAACAAGTCCCATTGTC
A
CCATATGGAGACATCATAGAGAAATGA


Translation (475 aa):
MSPEVTCPRRGHLPRFHPRTWVEPVVASSQVAASLYDAGLLLVVKASYGTGGSSNHSASPSPRGALEDQQ
Q
RAISNFYIIYNLVVGLSPLLSAYGLGWLSDRYHRKISICMSLLGFLLSRLGLLLKVLLDWPVEVLYGAA
A
LNGLFGGFSAFWSGVMALGSLGSSEGRRSVRLILIDLMLGLAGFCGSMASGHLFKQMAGHSGQGLILTA
C
SVSCASFALLYSLLVLKVPESVAKPSQELPAVDTVSGTVGTYRTLDPDQLDQQYAVGHPPSPGKAKPHK
T
TIALLFVGAIIYDLAVVGTVDVIPLFVLREPLGWNQVQVGYGMAAGYTIFITSFLGVLVFSRCFRDTTM
I
MIGMVSFGSGALLLAFVKETYMFYI
ARAVMLFALIPVTTIRSAMSKLIKGSSYGKVFVILQLSLALTGV
V
TSTLYNKIYQLTMDMFVGSCFALSSFLSFLAIIPI
SIVAYKQVPLSPYGDIIEK



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser