NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS45347.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
45347.1 Public Homo sapiens 15 SEMA4B 22 109 92 CCDS HistoryNCBI Gene:10509Re-query CCDS DB by CCDS ID:45347.1Re-query CCDS DB by GeneID:10509See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 6, NCBI annotation release 37.1, Ensembl annotation release 55

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 45347.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000332496.10 ENSP00000332204.6 Accepted alive Link to Ensembl Transcript Viewer:ENST00000332496.10Link to Ensembl Protein Viewer:ENSP00000332204.6Re-query CCDS DB by Nucleotide ID:ENST00000332496Re-query CCDS DB by Protein ID:ENSP00000332204
Original member Current member EBI,WTSI ENST00000411539.6 ENSP00000394720.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000411539.6Link to Ensembl Protein Viewer:ENSP00000394720.2Re-query CCDS DB by Nucleotide ID:ENST00000411539Re-query CCDS DB by Protein ID:ENSP00000394720
Original member NCBI NM_020210.3 NP_064595.2 Updated not alive Link to Nucleotide Sequence:NM_020210.3Link to Protein Sequence:NP_064595.2Re-query CCDS DB by Nucleotide ID:NM_020210Re-query CCDS DB by Protein ID:NP_064595
Current member NCBI NM_020210.4 NP_064595.2 Accepted alive Link to Nucleotide Sequence:NM_020210.4Link to Protein Sequence:NP_064595.2Re-query CCDS DB by Nucleotide ID:NM_020210Re-query CCDS DB by Protein ID:NP_064595Link to BLAST:NP_064595.2
Original member NCBI NM_198925.2 NP_945119.1 Updated not alive Link to Nucleotide Sequence:NM_198925.2Link to Protein Sequence:NP_945119.1Re-query CCDS DB by Nucleotide ID:NM_198925Re-query CCDS DB by Protein ID:NP_945119
Current member NCBI NM_198925.3 NP_945119.1 Accepted alive Link to Nucleotide Sequence:NM_198925.3Link to Protein Sequence:NP_945119.1Re-query CCDS DB by Nucleotide ID:NM_198925Re-query CCDS DB by Protein ID:NP_945119Link to BLAST:NP_945119.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_064595.2 837 Q9NPR2-1 837 100% 0 0
NP_945119.1 837 Q9NPR2-1 837 100% 0 0

Chromosomal Locations for CCDS 45347.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 15 (NC_000015.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 90201579 90201735 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 90217439 90217602 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 90217767 90217829 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 90219793 90219891 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 90220982 90221093 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 90221367 90221480 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 90221614 90221765 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 90223559 90223740 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 90223838 90223988 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 90224968 90225178 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 90225282 90225397 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 90225661 90225827 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 90227557 90227642 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 90227904 90228643 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2514 nt):
ATGCTGCGCACCGCGATGGGCCTGAGGAGCTGGCTCGCCGCCCCATGGGGCGCGCTGCCGCCTCGGCCAC
CG
CTGCTGCTGCTCCTGCTGCTGCTGCTCCTGCTGCAGCCGCCGCCTCCGACCTGGGCGCTCAGCCCCCG
G
ATCAGCCTGCCTCTGGGCTCTGAAGAGCGGCCATTCCTCAGATTCGAAGCTGAACACATCTCCAACTAC
ACA
GCCCTTCTGCTGAGCAGGGATGGCAGGACCCTGTACGTGGGTGCTCGAGAGGCCCTCTTTGCACTCA
GT
AGCAACCTCAGCTTCCTGCCAGGCGGGGAGTACCAGGAGCTGCTTTGGGGTGCAGACGCAGAGAAGAA
A
CAGCAGTGCAGCTTCAAGGGCAAGGACCCACAGCGCGACTGTCAAAACTACATCAAGATCCTCCTGCCG
CTC
AGCGGCAGTCACCTGTTCACCTGTGGCACAGCAGCCTTCAGCCCCATGTGTACCTACATCAACATGG
AG
AACTTCACCCTGGCAAGGGACGAGAAGGGGAATGTCCTCCTGGAAGATGGCAAGGGCCGTTGTCCCTT
C
GACCCGAATTTCAAGTCCACTGCCCTGGTGGTTGATGGCGAGCTCTACACTGGAACAGTCAGCAGCTTC
CAA
GGGAATGACCCGGCCATCTCGCGGAGCCAAAGCCTTCGCCCCACCAAGACCGAGAGCTCCCTCAACT
GG
CTGCAAGACCCAGCTTTTGTGGCCTCAGCCTACATTCCTGAGAGCCTGGGCAGCTTGCAAGGCGATGA
T
GACAAGATCTACTTTTTCTTCAGCGAGACTGGCCAGGAATTTGAGTTCTTTGAGAACACCATTGTGTCC
CGC
ATTGCCCGCATCTGCAAGGGCGATGAGGGTGGAGAGCGGGTGCTACAGCAGCGCTGGACCTCCTTCC
TC
AAGGCCCAGCTGCTGTGCTCACGGCCCGACGATGGCTTCCCCTTCAACGTGCTGCAGGATGTCTTCAC
G
CTGAGCCCCAGCCCCCAGGACTGGCGTGACACCCTTTTCTATGGGGTCTTCACTTCCCAGTGGCACAGG
GGA
ACTACAGAAGGCTCTGCCGTCTGTGTCTTCACAATGAAGGATGTGCAGAGAGTCTTCAGCGGCCTCT
AC
AAGGAGGTGAACCGTGAGACACAGCAGTGGTACACCGTGACCCACCCGGTGCCCACACCCCGGCCTGG
A
GCGTGCATCACCAACAGTGCCCGGGAAAGGAAGATCAACTCATCCCTGCAGCTCCCAGACCGCGTGCTG
AAC
TTCCTCAAGGACCACTTCCTGATGGACGGGCAGGTCCGAAGCCGCATGCTGCTGCTGCAGCCCCAGG
CT
CGCTACCAGCGCGTGGCTGTACACCGCGTCCCTGGCCTGCACCACACCTACGATGTCCTCTTCCTGGG
C
ACTGGTGACGGCCGGCTCCACAAGGCAGTGAGCGTGGGCCCCCGGGTGCACATCATTGAGGAGCTGCAG
ATC
TTCTCATCGGGACAGCCCGTGCAGAATCTGCTCCTGGACACCCACAGGGGGCTGCTGTATGCGGCCT
CA
CACTCGGGCGTAGTCCAGGTGCCCATGGCCAACTGCAGCCTGTACAGGAGCTGTGGGGACTGCCTCCT
C
GCCCGGGACCCCTACTGTGCTTGGAGCGGCTCCAGCTGCAAGCACGTCAGCCTCTACCAGCCTCAGCTG
GCC
ACCAGGCCGTGGATCCAGGACATCGAGGGAGCCAGCGCCAAGGACCTTTGCAGCGCGTCTTCGGTTG
TG
TCCCCGTCTTTTGTACCAACAGGGGAGAAGCCATGTGAGCAAGTCCAGTTCCAGCCCAACACAGTGAA
C
ACTTTGGCCTGCCCGCTCCTCTCCAACCTGGCGACCCGACTCTGGCTACGCAACGGGGCCCCCGTCAAT
GCC
TCGGCCTCCTGCCACGTGCTACCCACTGGGGACCTGCTGCTGGTGGGCACCCAACAGCTGGGGGAGT
TC
CAGTGCTGGTCACTAGAGGAGGGCTTCCAGCAGCTGGTAGCCAGCTACTGCCCAGAGGTGGTGGAGGA
C
GGGGTGGCAGACCAAACAGATGAGGGTGGCAGTGTACCCGTCATTATCAGCACATCGCGTGTGAGTGCA
CCA
GCTGGTGGCAAGGCCAGCTGGGGTGCAGACAGGTCCTACTGGAAGGAGTTCCTGGTGATGTGCACGC
TC
TTTGTGCTGGCCGTGCTGCTCCCAGTTTTATTCTTGCTCTACCGGCACCGGAACAGCATGAAAGTCTT
C
CTGAAGCAGGGGGAATGTGCCAGCGTGCACCCCAAGACCTGCCCTGTGGTGCTGCCCCCTGAGACCCGC
CCA
CTCAACGGCCTAGGGCCCCCTAGCACCCCGCTCGATCACCGAGGGTACCAGTCCCTGTCAGACAGCC
CC
CCGGGGTCCCGAGTCTTCACTGAGTCAGAGAAGAGGCCACTCAGCATCCAAGACAGCTTCGTGGAGGT
A
TCCCCAGTGTGCCCCCGGCCCCGGGTCCGCCTTGGCTCGGAGATCCGTGACTCTGTGGTGTGA


Translation (837 aa):
MLRTAMGLRSWLAAPWGALPPRPPLLLLLLLLLLLQPPPPTWALSPRISLPLGSEERPFLRFEAEHISNY
T
ALLLSRDGRTLYVGAREALFALSSNLSFLPGGEYQE
LLWGADAEKKQQCSFKGKDPQRDCQNYIKILLP
L
SGSHLFTCGTAAFSPMCTYI
NMENFTLARDEKGNVLLEDGKGRCPFDPNFKSTALVVDGELYTGTVSSF
Q
GNDPAISRSQSLRPTKTESSLNWLQ
DPAFVASAYIPESLGSLQGDDDKIYFFFSETGQEFEFFENTIVS
R
IARICK
GDEGGERVLQQRWTSFLKAQLLCSRPDDGFPFNVLQDVFTLSPSPQDWRDTLFYGVFTSQWHR
G
TTEGSAVCVFTMKDVQRVFSGLYKEVNRETQQWYTVTHPVPTPRPGA
CITNSARERKINSSLQLPDRVL
N
FLKDHFLMDGQVRSRMLLLQPQARYQRVAVHRVPGLHHTYDVLFLGT
GDGRLHKAVSVGPRVHIIEELQ
I
FSSGQPVQNLLLDTHR
GLLYAASHSGVVQVPMANCSLYRSCGDCLLARDPYCAWSGSSCKHVSLYQPQL
A
T
RPWIQDIEGASAKDLCSASSVVSPSFVPTGEKPCEQVQFQPNTVNTLACPLLSNLATRLWLRNGAPVN
A
SASCHVLPTGDLLLVGTQQLGEFQCWSLEEGFQQLVASYCPEVVEDGVADQTDEGGSVPVIISTSRVSA
P
AGGKASWGADRSYWKEFLVMCTLFVLAVLLPVLFLLYRHRNSMKVFLKQGECASVHPKTCPVVLPPETR
P
LNGLGPPSTPLDHRGYQSLSDSPPGSRVFTESEKRPLSIQDSFVEVSPVCPRPRVRLGSEIRDSVV




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser