NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS3287.2 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
3287.2 Public Homo sapiens 3 RTP1 22 109 92 CCDS HistoryNCBI Gene:132112Re-query CCDS DB by CCDS ID:3287.2Re-query CCDS DB by GeneID:132112See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)

Sequence IDs included in CCDS 3287.2

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000312295.4 ENSP00000311712.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000312295.4Link to Ensembl Protein Viewer:ENSP00000311712.4Re-query CCDS DB by Nucleotide ID:ENST00000312295Re-query CCDS DB by Protein ID:ENSP00000311712
Original member Current member NCBI NM_153708.2 NP_714919.2 Accepted alive Link to Nucleotide Sequence:NM_153708.2Link to Protein Sequence:NP_714919.2Re-query CCDS DB by Nucleotide ID:NM_153708Re-query CCDS DB by Protein ID:NP_714919Link to BLAST:NP_714919.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_714919.2 263 P59025 263 100% 0 0

Chromosomal Locations for CCDS 3287.2

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 3 (NC_000003.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 187197516 187197787 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 187199551 187200070 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (792 nt):
ATGAGGATTTTTAGACCGTGGAGACTGCGCTGCCCTGCCCTGCACCTACCCTCACTCTCCGTGTTCTCAC
TA
AGGTGGAAATTGCCTTCCCTCACTACTGACGAGACCATGTGTAAAAGCGTGACCACAGATGAGTGGAA
G
AAAGTCTTCTATGAGAAGATGGAGGAGGCAAAGCCGGCTGACAGCTGGGACCTCATCATAGACCCCAAC
CTC
AAGCACAATGTGCTGAGCCCTGGTTGGAAGCAGTACCTGGAATTGCATGCTTCAGGCAGGTTCCACT
GC
TCCTGGTGCTGGCACACCTGGCAGTCGCCCTACGTGGTCATCCTCTTCCACATGTTCCTGGACCGCGC
C
CAGCGGGCGGGCTCGGTGCGCATGCGCGTCTTCAAGCAGCTGTGCTATGAGTGCGGCACGGCGCGGCTG
GAC
GAGTCCAGCATGCTGGAGGAGAACATCGAGGGCCTGGTGGACAACCTCATCACCAGCCTGCGCGAGC
AG
TGCTACGGCGAGCGTGGCGGCCAGTACCGCATCCACGTGGCCAGCCGCCAGGACAACCGGCGGCACCG
C
GGAGAGTTCTGCGAGGCCTGCCAGGAGGGCATCGTGCACTGGAAGCCCAGCGAGAAGCTGCTGGAGGAG
GAG
GCGACCACCTACACCTTCTCCCGGGCGCCCAGCCCCACCAAGTCGCAGGACCAGACGGGCTCAGGCT
GG
AACTTCTGCTCTATCCCCTGGTGCTTGTTTTGGGCCACGGTCCTGCTGCTGATCATCTACCTGCAGTT
C
TCTTTCCGTAGCTCCGTATAA


Translation (263 aa):
MRIFRPWRLRCPALHLPSLSVFSLRWKLPSLTTDETMCKSVTTDEWKKVFYEKMEEAKPADSWDLIIDPN
L
KHNVLSPGWKQYLELHASG
RFHCSWCWHTWQSPYVVILFHMFLDRAQRAGSVRMRVFKQLCYECGTARL
D
ESSMLEENIEGLVDNLITSLREQCYGERGGQYRIHVASRQDNRRHRGEFCEACQEGIVHWKPSEKLLEE
E
ATTYTFSRAPSPTKSQDQTGSGWNFCSIPWCLFWATVLLLIIYLQFSFRSSV




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser