NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS44755.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
44755.1 Public Homo sapiens 11 ROBO3 22 109 92 CCDS HistoryNCBI Gene:64221Re-query CCDS DB by CCDS ID:44755.1Re-query CCDS DB by GeneID:64221See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 6, NCBI annotation release 37.1, Ensembl annotation release 55

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 44755.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000397801.5 ENSP00000380903.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000397801.5Link to Ensembl Protein Viewer:ENSP00000380903.1Re-query CCDS DB by Nucleotide ID:ENST00000397801Re-query CCDS DB by Protein ID:ENSP00000380903
Original member Current member NCBI NM_022370.3 NP_071765.2 Accepted alive Link to Nucleotide Sequence:NM_022370.3Link to Protein Sequence:NP_071765.2Re-query CCDS DB by Nucleotide ID:NM_022370Re-query CCDS DB by Protein ID:NP_071765Link to BLAST:NP_071765.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_071765.2 1386 Q96MS0-1 1386 100% 0 0

Chromosomal Locations for CCDS 44755.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 11 (NC_000011.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 124865578 124865737 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 124868802 124869128 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 124869450 124869607 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 124869948 124870068 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 124870165 124870303 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 124870601 124870728 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 124871014 124871138 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 124872381 124872552 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 124872884 124873089 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 124873310 124873391 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 124873697 124873862 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 124874070 124874236 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 124874788 124874909 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 124875111 124875336 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 124875564 124875685 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 124875954 124876125 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 124876275 124876460 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 124877161 124877184 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 124877267 124877309 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 124877519 124877658 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 124877937 124878131 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 124878298 124878436 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 124878584 124878796 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 124879190 124879341 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 124879465 124879575 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 124879787 124879948 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 124880418 124880608 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 124881239 124881250 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (4161 nt):
ATGCTGCGCTACCTGCTGAAAACGCTGCTGCAGATGAACTTGTTCGCGGACTCTCTGGCCGGGGACATCT
CC
AACTCCAGCGAGCTGCTCTTGGGCTTCAACTCCTCGCTGGCGGCGCTCAACCACACCCTGCTGCCTCC
C
GGCGATCCCTCTCTCAACGGGTCAAGGGTAGGACCGGAGGACGCTATGCCCCGCATCGTGGAGCAGCCG
CCA
GATCTGCTGGTCTCCCGAGGCGAGCCCGCCACGTTGCCCTGCCGCGCTGAAGGCCGACCCCGACCCA
AC
ATTGAGTGGTACAAGAACGGGGCGCGTGTGGCCACTGTGCGGGAGGATCCGCGTGCGCACCGCCTGCT
G
CTGCCCAGCGGCGCCCTCTTCTTCCCGCGCATCGTGCACGGGCGCCGCGCGCGGCCGGACGAAGGTGTC
TAC
ACTTGCGTGGCTCGCAACTACCTGGGGGCAGCAGCGAGCAGAAACGCCTCGCTGGAAGTGGCAGTCC
TC
CGTGATGATTTCCGGCAGTCTCCTGGAAACGTGGTGGTGGCAGTGGGGGAGCCAGCAGTACTGGAATG
C
GTGCCCCCCCGCGGCCACCCGGAGCCTTCCGTGTCCTGGAGGAAGGACGGTGCAAGACTCAAGGAAGAG
GAA
GGAAGGATCACGATCCGTGGAGGGAAGCTGATGATGTCACATACACTCAAGAGCGATGCAGGCATGT
AT
GTGTGCGTAGCCTCCAACATGGCGGGAGAACGGGAGAGTGCGGCAGCTGAAGTCATGGTACTGGAGCG
T
CCCTCATTCCTGCGCAGACCAGTGAATCAGGTGGTCCTGGCTGATGCCCCTGTGACTTTCCTATGTGAG
GTG
AAGGGGGATCCCCCACCTCGTCTACGCTGGCGCAAGGAGGATGGGGAACTGCCCACAGGCAGGTATG
AG
ATCCGGAGTGACCACAGCCTTTGGATTGGGCATGTGAGTGCCGAAGATGAGGGAACGTACACCTGTGT
G
GCGGAGAACAGTGTGGGCCGCGCTGAAGCATCTGGCTCCCTCAGTGTTCACGTCCCACCCCAGTTGGTG
ACC
CAGCCCCAGGACCAGATGGCAGCTCCTGGAGAGAGCGTGGCTTTCCAGTGCGAGACCAAAGGAAACC
CC
CCACCTGCCATCTTCTGGCAGAAGGAGGGGAGTCAGGTCCTGCTTTTCCCCAGTCAGTCACTTCAGCC
G
ACGGGGCGCTTCTCAGTGTCTCCAAGAGGCCAACTTAACATCACCGCGGTGCAGCGTGGGGATGCTGGG
TAC
TACGTGTGCCAGGCTGTCAGTGTGGCTGGCAGCATCCTGGCCAAGGCCCTGCTGGAGATAAAAGGAG
CC
TCTTTGGATGGGCTGCCTCCTGTCATCCTCCAGGGACCAGCCAATCAGACGCTGGTGCTTGGCTCCTC
C
GTGTGGCTGCCCTGCAGAGTGACTGGGAACCCTCAACCCAGTGTCCGATGGAAGAAGGATGGGCAGTGG
CTG
CAGGGGGATGACCTCCAGTTCAAGACAATGGCCAACGGTACCCTGTACATCGCCAATGTGCAGGAGA
TG
GACATGGGCTTCTACAGCTGCGTGGCCAAGAGTTCCACAGGGGAAGCCACATGGAGCGGCTGGCTTAA
G
ATGCGGGAAGACTGGGGAGTATCACCAGACCCCCCTACAGAACCCAGTTCCCCTCCGGGGGCTCCCTCT
CAG
CCAGTGGTCACTGAGATCACCAAGAACAGCATTACCCTGACCTGGAAGCCCAACCCACAAACTGGGG
CT
GCAGTCACGTCTTATGTGATAGAGGCCTTCAGCCCAGCAGCTGGCAACACATGGCGTACTGTGGCAGA
T
GGCGTGCAGCTGGAGACACACACAGTCAGCGGTCTGCAGCCCAATACCATCTACCTGTTTCTGGTTCGA
GCA
GTGGGAGCCTGGGGCCTCAGTGAGCCCAGCCCCGTCTCTGAGCCTGTCCGTACACAGGATAGCAGCC
CC
TCTAGGCCAGTGGAGGACCCATGGAGAGGCCAGCAGGGACTGGCGGAAGTGGCTGTGCGCCTGCAGGA
G
CCCATAGTCCTGGGACCCCGGACCCTGCAGGTGTCCTGGACTGTGGATGGCCCAGTCCAGCTGGTGCAA
GGT
TTCCGGGTGTCTTGGAGGGTAGCAGGCCCTGAGGGAGGAAGCTGGACAATGTTGGACCTACAGTCCC
CA
AGCCAGCAAAGTACTGTGCTAAGAGGACTCCCTCCAGGGACCCAAATCCAGATCAAGGTGCAAGCCCA
A
GGCCAGGAGGGGCTGGGGGCTGAAAGCCTCTCTGTGACCAGGAGCATTCCTGAGGAGGCCCCCAGTGGC
CCC
CCACAGGGAGTGGCGGTGGCCTTGGGGGGTGATGGCAACAGCAGTATCACTGTGTCCTGGGAACCTC
CA
CTCCCCTCCCAGCAAAATGGGGTCATCACGGAATACCAGATCTGGTGCCTGGGCAATGAGAGCCGCTT
T
CACCTCAATCGATCTGCAGCAGGCTGGGCACGCTCCGCAATGCTCCGAGGACTGGTGCCCGGTCTCCTC
TAT
CGAACCCTGGTCGCGGCGGCCACCAGCGCAGGCGTGGGCGTGCCCAGTGCCCCAGTGCTGGTGCAGC
TG
CCGTCCCCGCCGGACCTGGAGCCCGGGCTGGAGGTGGGCGCGGGGCTGGCGGTGCGGCTGGCGAGGGT
G
CTGCGGGAGCCCGCCTTCCTCGCGGGCAGCGGCGCAGCCTGCGGGGCGCTGCTTCTCGGGCTCTGCGCC
GCC
CTCTACTGGCGCCGGAAACAGCGCAAAGAGCTCAGCCACTACACGGCCTCTTTTGCCTACACACCGG
CA
GTGTCCTTCCCGCACTCAGAGGGCCTCTCTGGAGCCAGTTCCAGGCCACCCATGGGCCTTGGCCCCGC
C
CCCTACTCATGGCTGGCAGATTCGTGGCCCCACCCATCTCGAAGCCCCTCGGCCCAGGAACCCAGGGGA
AGC
TGCTGCCCTAGCAATCCTGACCCGGACGACAGATATTACAACGAAGCGGGAATCTCCCTGTATCTAG
CT
CAGACGGCCAGGGGCACGGCCGCCCCTGGCGAGGGTCCTGTCTATAGCACCATTGACCCAGCGGGGGA
G
GAGCTGCAGACCTTCCATGGGGGCTTCCCCCAACATCCCTCAGGAGATCTGGGTCCCTGGAGCCAGTAC
GCT
CCTCCAGAGTGGAGCCAGGGGGACAGTGGAGCCAAGGGAGGCAAAGTGAAGCTTCTGGGGAAACCTG
TG
CAGATGCCCTCTCTGAACTGGCCAGAAGCCCTGCCCCCACCTCCTCCTTCTTGTGAACTGAGCTGCCT
A
GAAGGGCCGGAGGAGGAGCTGGAGGGCAGCTCAGAGCCAGAGGAGTGGTGCCCGCCAATGCCTGAGAGA
AGT
CACCTGACGGAGCCCAGCTCCAGTGGAGGGTGCCTGGTCACCCCATCCCGAAGGGAAACCCCCTCTC
CC
ACACCTTCCTATGGACAGCAGTCCACAGCCACTCTTACACCCTCACCTCCTGACCCTCCCCAGCCCCC
A
ACTGACATGCCCCATCTCCATCAGATGCCCAGGAGGGTGCCCCTTGGGCCGAGTTCCCCTCTCAGTGTA
TCC
CAGCCCATGCTGGGCATCCGTGAAGCGAGGCCTGCTGGCTTGGGTGCTGGCCCTGCAGCCTCACCCC
AC
CTCAGCCCCAGTCCTGCCCCTAGCACAGCCAGCAGTGCCCCAGGCAGAACCTGGCAGGGGAATGGGGA
G
ATGACTCCCCCACTTCAAGGACCCCGTGCTCGATTCCGGAAGAAACCCAAGGCTCTTCCCTACAGGAGG
GAG
AACAGTCCTGGGGACTTGCCCCCACCACCCTTGCCACCGCCAGAGGAAGAGGCGAGCTGGGCCCTAG
AG
CTGAGGGCAGCAGGCAGCATGTCCTCCCTGGAGCGGGAGCGCAGTGGGGAGAGGAAAGCGGTCCAGGC
C
GTGCCCCTGGCAGCCCAGCGGGTGCTCCACCCAGATGAAGAGGCCTGGCTCCCATACAGCAGACCAAGC
TTC
CTGTCCCGGGGCCAGGGCACCAGCACATGTTCCACGGCCGGCAGCAACTCTTCCAGGGGCTCCAGCA
GC
TCTAGGGGCTCCCGGGGCCCTGGCCGGAGCCGGAGTCGGAGTCAGAGCCGGAGCCAGAGCCAAAGGCC
A
GGACAGAAACGCCGAGAGGAACCAAGATGA


Translation (1386 aa):
MLRYLLKTLLQMNLFADSLAGDISNSSELLLGFNSSLAALNHTLLPPGDPSLNGSRVGPEDAMPRIVEQP
P
DLLVSRGEPATLPCRAEGRPRPNIEWYKNGARVATVREDPRAHRLLLPSGALFFPRIVHGRRARPDEGV
Y
TCVARNYLGAAASRNASLEVA
VLRDDFRQSPGNVVVAVGEPAVLECVPPRGHPEPSVSWRKDGARLKEE
E
GRIT
IRGGKLMMSHTLKSDAGMYVCVASNMAGERESAAAEVMVLERPSFLRRPVNQVVLADAPVTFLCE
V
KGDPPPRLRWRKEDGELPTG
RYEIRSDHSLWIGHVSAEDEGTYTCVAENSVGRAEASGSLSVHVPPQLV
T
QPQDQMAAPGESVAFQCETKGNPPPAIFWQKEGSQ
VLLFPSQSLQPTGRFSVSPRGQLNITAVQRGDAG
Y
YVCQAVSVAGSILAKALLEIKG
ASLDGLPPVILQGPANQTLVLGSSVWLPCRVTGNPQPSVRWKKDGQW
L
QGDDLQFKTMANGTLYIANVQ
EMDMGFYSCVAKSSTGEATWSGWLKMREDWGVSPDPPTEPSSPPGAPS
Q
PVVTEITKNSITLTWKPNPQTGAAVTSYVIEAF
SPAAGNTWRTVADGVQLETHTVSGLQPNTIYLFLVR
A
VGAWGLSEPSPVSEPVRTQ
DSSPSRPVEDPWRGQQGLAEVAVRLQEPIVLGPRTLQVSWTVDGPVQLVQ
G
FRVSWRVAGPEGGSWTMLDLQSPSQQSTVLRGLPPGTQIQIKVQAQGQEGLGAESLSVTRSIPEE
APSG
P
PQGVAVALGGDGNSSITVSWEPPLPSQQNGVITEYQ
IWCLGNESRFHLNRSAAGWARSAMLRGLVPGLL
Y
RTLVAAATSAGVGVPSAPVLVQL
PSPPDLEPGLEVGAGLAVRLARVLREPAFLAGSGAACGALLLGLCA
A
LYWRRKQRKELSHYT
ASFAYTPAVSFPHSEGLSGASSRPPMGLGPAPYSWLADSWPHPSRSPSAQEPRG
S
CCPSNPDPDDRYYN
EAGISLYLAQTARGTAAPGEGPVYSTIDPAGEELQTFHGGFPQHPSGDLGPWSQY
A
PPEWSQGDS
GAKGGKVKLLGKPVQMPSLNWPEALPPPPPSCELSCLEGPEEELEGSSEPEEWCPPMPER
S
HLTEPSSSGGCLVTPSRRETPSPTPSYGQQSTATLTPSPPDPPQPPTDMPHLHQMP
RRVPLGPSSPLSV
S
QPMLGIREARPAGLGAGPAASPHLSPSPAPSTASSAP
GRTWQGNGEMTPPLQGPRARFRKKPKALPYRR
E
NSPG
DLPPPPLPPPEEEASWALELRAAGSMSSLERERSGERKAVQAVPLAAQRVLHPDEEAWLPYSRPS
F
LSRGQGTSTCSTAGSNSSRGSSSSRGSRGPGRSRSRSQSRSQSQRPGQKRRE
EPR



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser