NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS32035.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
32035.1 Public Homo sapiens 14 RNASE10 22 109 92 CCDS HistoryNCBI Gene:338879Re-query CCDS DB by CCDS ID:32035.1Re-query CCDS DB by GeneID:338879See the combined annotation on chromosome 14 in Sequence Viewer

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 32035.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000328444.5 ENSP00000333358.5 Accepted alive Link to Ensembl Transcript Viewer:ENST00000328444.5Link to Ensembl Protein Viewer:ENSP00000333358.5Re-query CCDS DB by Nucleotide ID:ENST00000328444Re-query CCDS DB by Protein ID:ENSP00000333358
Original member Current member NCBI NM_001012975.1 NP_001012993.1 Accepted alive Link to Nucleotide Sequence:NM_001012975.1Link to Protein Sequence:NP_001012993.1Re-query CCDS DB by Nucleotide ID:NM_001012975Re-query CCDS DB by Protein ID:NP_001012993Link to BLAST:NP_001012993.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001012993.1 216 Q5GAN6-1 216 100% 0 0

Chromosomal Locations for CCDS 32035.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 14 (NC_000014.9)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14See the combined annotation on chromosome 14 in Sequence Viewer

Chromosome Start Stop Links
14 20510472 20511122 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (651 nt):
ATGAAGCTGAATCTGGTGCAGATCTTTTTCATGTTGCTGATGCTGCTGCTGGGCCTGGGGATGGGCCTGG
GG
TTGGGACTTCATATGGCTACAGCAGTCTTGGAGGAGAGTGATCAACCGCTCAATGAATTTTGGTCCAG
T
GACTCACAGGACAAAGCTGAGGCCACTGAGGAGGGAGACGGCACCCAAACCACAGAAACGCTGGTGCTT
AGC
AACAAAGAAGTGGTGCAACCTGGCTGGCCAGAAGATCCCATCCTCGGTGAAGATGAGGTTGGGGGTA
AC
AAGATGCTCAGAGCCTCAGCTCTCTTTCAGAGCAACAAAGACTATCTTAGGCTTGACCAGACAGATAG
A
GAATGCAATGATATGATGGCACACAAGATGAAGGAGCCCAGTCAGAGTTGCATAGCCCAGTATGCATTC
ATC
CATGAGGATCTAAACACAGTCAAAGCTGTCTGTAACAGTCCTGTCATTGCCTGTGAGCTCAAGGGGG
GA
AAATGTCACAAAAGCTCCCGACCTTTTGATTTGACATTGTGCGAGCTGTCCCAACCAGACCAGGTCAC
T
CCTAACTGCAATTACCTAACTTCTGTTATAAAAAAGCACATTATTATAACCTGTAATGACATGAAGCGC
CAG
TTACCAACTGGACAATGA


Translation (216 aa):
MKLNLVQIFFMLLMLLLGLGMGLGLGLHMATAVLEESDQPLNEFWSSDSQDKAEATEEGDGTQTTETLVL
S
NKEVVQPGWPEDPILGEDEVGGNKMLRASALFQSNKDYLRLDQTDRECNDMMAHKMKEPSQSCIAQYAF
I
HEDLNTVKAVCNSPVIACELKGGKCHKSSRPFDLTLCELSQPDQVTPNCNYLTSVIKKHIIITCNDMKR
Q
LPTGQ




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser