NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS6460.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
6460.1 Public Homo sapiens 9 RLN2 22 109 92 CCDS HistoryNCBI Gene:6019Re-query CCDS DB by CCDS ID:6460.1Re-query CCDS DB by GeneID:6019See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 6460.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000381627.3 ENSP00000371040.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000381627.3Link to Ensembl Protein Viewer:ENSP00000371040.3Re-query CCDS DB by Nucleotide ID:ENST00000381627Re-query CCDS DB by Protein ID:ENSP00000371040
Original member Current member NCBI NM_134441.2 NP_604390.1 Accepted alive Link to Nucleotide Sequence:NM_134441.2Link to Protein Sequence:NP_604390.1Re-query CCDS DB by Nucleotide ID:NM_134441Re-query CCDS DB by Protein ID:NP_604390Link to BLAST:NP_604390.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_604390.1 185 P04090-1 185 100% 0 0

Chromosomal Locations for CCDS 6460.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 9 (NC_000009.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 5300098 5300444 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 5304370 5304580 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (558 nt):
ATGCCTCGCCTGTTTTTTTTCCACCTGCTAGGAGTCTGTTTACTACTGAACCAATTTTCCAGAGCAGTCG
CG
GACTCATGGATGGAGGAAGTTATTAAATTATGCGGCCGCGAATTAGTTCGCGCGCAGATTGCCATTTG
C
GGCATGAGCACCTGGAGCAAAAGGTCTCTGAGCCAGGAAGATGCTCCTCAGACACCTAGACCAGTGGCA
G
AA
ATTGTGCCATCCTTCATCAACAAAGATACAGAAACCATAAATATGATGTCAGAATTTGTTGCTAATT
TG
CCACAGGAGCTGAAGTTAACCCTGTCTGAGATGCAGCCAGCATTACCACAGCTACAACAACATGTACC
T
GTATTAAAAGATTCCAGTCTTCTCTTTGAAGAATTTAAGAAACTTATTCGCAATAGACAAAGTGAAGCC
GCA
GACAGCAGTCCTTCAGAATTAAAATACTTAGGCTTGGATACTCATTCTCGAAAAAAGAGACAACTCT
AC
AGTGCATTGGCTAATAAATGTTGCCATGTTGGTTGTACCAAAAGATCTCTTGCTAGATTTTGCTGA


Translation (185 aa):
MPRLFFFHLLGVCLLLNQFSRAVADSWMEEVIKLCGRELVRAQIAICGMSTWSKRSLSQEDAPQTPRPVA
E
IVPSFINKDTETINMMSEFVANLPQELKLTLSEMQPALPQLQQHVPVLKDSSLLFEEFKKLIRNRQSEA
A
DSSPSELKYLGLDTHSRKKRQLYSALANKCCHVGCTKRSLARFC




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser