NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS59506.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
59506.1 Public Homo sapiens 7 RASA4B 22 109 92 CCDS HistoryNCBI Gene:100271927Re-query CCDS DB by CCDS ID:59506.1Re-query CCDS DB by GeneID:100271927See the combined annotation on chromosome 7 in Sequence Viewer

Public Note for CCDS 59506.1
The exon combination of this transcript is based on the paralogous transcript alignment AK026441.1.

Public since: CCDS release 12, NCBI annotation release 104, Ensembl annotation release 71

Review status: Reviewed (by CCDS collaboration)


Attributes
Inferred exon combination

Sequence IDs included in CCDS 59506.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000541662.5 ENSP00000440982.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000541662.5Link to Ensembl Protein Viewer:ENSP00000440982.1Re-query CCDS DB by Nucleotide ID:ENST00000541662Re-query CCDS DB by Protein ID:ENSP00000440982
Original member Current member NCBI NM_001277335.1 NP_001264264.1 Accepted alive Link to Nucleotide Sequence:NM_001277335.1Link to Protein Sequence:NP_001264264.1Re-query CCDS DB by Nucleotide ID:NM_001277335Re-query CCDS DB by Protein ID:NP_001264264Link to BLAST:NP_001264264.1

Chromosomal Locations for CCDS 59506.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 7 (NC_000007.14)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 102483592 102483713 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 102483825 102483889 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 102485039 102485159 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 102488463 102488598 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 102493116 102493285 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 102493825 102493969 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 102494538 102494675 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 102494881 102495073 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 102495278 102495390 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 102496140 102496204 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 102496469 102496619 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 102496847 102496964 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 102500699 102500793 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 102501096 102501227 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 102503163 102503244 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 102506695 102506824 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 102509599 102509660 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 102510179 102510292 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 102511925 102511981 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 102517646 102517710 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2274 nt):
ATGGCCAAGCGCAGCTCGCTGTACATCCGCATCGTGGAGGGGAAGAACCTTCCCGCCAAGGACATCACTG
GC
AGCAGCGACCCCTACTGCATCGTGAAGGTGGACAATGAGCCCATCATCAGGACAGCCACAGTGTGGAA
G
ACCCTGTGCCCCTTCTGGGGTGAGGAGTACCAAGTGCACCTGCCGCCCACCTTCCACGCTGTGGCTTTC
TAT
GTCATGGATGAGGATGCCCTCAGCCGGGACGACGTTATCGGAAAGGTCTGCCTTACAAGGGACACCA
TA
GCCTCTCACCCTAAGGGTTTCAGCGGGTGGGCCCACCTGACAGAGGTCGACCCCGACGAGGAGGTGCA
G
GGCGAGATCCACCTGCGGCTGGAAGTGTGGCCAGGGGCCCGGGCCTGCCGGCTACGCTGCTCTGTGCTG
GAG
GCCAGGGATCTGGCCCCAAAGGACCGCAATGGCACATCTGACCCCTTCGTCCGAGTGCGCTACAAGG
GC
CGGACACGGGAGACCTCGATCGTGAAGAAGTCATGCTACCCACGCTGGAATGAGACGTTTGAATTTGA
G
CTGCAGGAGGGGGCCATGGAGGCGCTGTGCGTGGAGGCCTGGGACTGGGACCTTGTCAGCCGAAACGAC
TTC
CTGGGCAAAGTGGTGATTGATGTCCAGAGACTGCGGGTGGTGCAGCAGGAGGAGGGCTGGTTCCGGC
TG
CAGCCCGACCAGTCCAAGAGCCGGCGGCATGACGAGGGCAACCTGGGCTCCTTGCAGCTGGAGGTGCG
G
CTGCGGGACGAGACGGTGCTGCCCTCCAGCTACTACCAGCCACTGGTGCACCTGCTGTGCCACGAGGTC
AAG
CTGGGCATGCAGGGCCCAGGGCAGCTGATCCCACTCATCGAGGAGACAACCAGCACCGAGTGTCGCC
AG
GACGTGGCCACGAACCTGCTCAAGCTCTTCCTGGGGCAGGGGCTGGCCAAGGACTTCCTGGACCTGCT
C
TTCCAGCTGGAGCTGAGTCGCACCAGTGAGACCAACACCCTGTTCCGGAGCAACTCTCTGGCCTCAAAG
TCC
GTGGAGTCTTTTCTGAAGGTGGCCGGGATGCAGTACCTGCACGGCGTCCTGGGCCCCATCATCAACA
AG
GTGTTTGAGGAGAAGAAGTACGTGGAGCTGGACCCCAGCAAAGTGGAAGTTAAGGATGTAGGGTGCTC
C
GGGCTGCACCGCCCGCAGACCGAGGCCGAGGTGCTGGAGCAGAGCGCGCAGACGCTGCGCGCCCACCTG
GGG
GCCCTGCTGAGCGCGCTCAGCCGCTCGGTTCGCGCGTGCCCCGCCGTGGTGCGCGCCACCTTCCGCC
AG
CTCTTCCGGCGCGTGCGCGAGCGCTTCCCCGGCGCCCAGCACGAGAATGTACCGTTCATCGCCGTCAC
C
AGCTTCCTGTGCCTGCGCTTCTTCTCTCCCGCCATCATGTCGCCCAAGCTCTTCCACCTGCGGGAGCGC
CAC
GCGGACGCCCGCACCAGCCGCACCCTGCTCCTGTTGGCCAAGGCAGTCCAGAACGTGGGCAACATGG
AC
ACGCCGGCTTCCAGGGCCAAGGAGGCTTGGATGGAGCCGCTGCAGCCCACCGTGCACCAGGGCGTGGC
G
CAGCTGAAGGACTTCATCACCAAGCTCGTGGACATCGAGGAGAAGGACGAGCTGGACCTGCAGCGGACG
CTG
AGTTTGCAGGCGCCACCTGTGAAGGAGGGGCCACTCTTCATCCACAGGACCAAGGGCAAGGGCCCCC
TC
ATGTCCTCCTCCTTCAAGAAGCTCTACTTCTCCCTCACTACCGAGGCCCTCAGCTTCGCGAAGACGCC
C
AGCTCCAAGTGTGTGAATGAGCTTAACCAGTGGCTGTCTGCGCTGCGGAAGGTGAGCATCAACAACACC
GGA
CTGCTGGGCTCCTACCACCCTGGCGTCTTCCGTGGGGACAAGTGGAGCTGCTGCCACCAAAAAGAGA
AG
ACAGGTCAGGGCTGCGATAAGACCCGGTCACGGGTGACCCTGCAGGAGTGGAATGACCCTCTTGACCA
T
GACCTTGAGGCCCAGCTCATCTACCGGCACCTGCTGGGCGTGGAGGCCATGCTGTGGGAGAGGCACCGG
GAG
CTGAGCGGGGGCGCAGAGGCAGGCACGGTGCCCACGAGCCCTGGCAAAGTCCCCGAGGACTCATTGG
CC
CGGCTGCTCCGGGTGCTGCAGGACCTCCGCGAGGCCCATAGCTCCAGCCCGGCCGGCTCCCCACCCTC
A
GAGCCCAACTGCCTCCTGGAGCTGCAGACGTGA


Translation (757 aa):
MAKRSSLYIRIVEGKNLPAKDITGSSDPYCIVKVDNEPIIRTATVWKTLCPFWGEEYQVHLPPTFHAVAF
Y
VMDEDAL
SRDDVIGKVCLTRDTIASHPKGFSGWAHLTEVDPDEEVQGEIHLRLEVWPGARACRLRCSVL
E
A
RDLAPKDRNGTSDPFVRVRYKGRTRETSIVKKSCYPRWNETFEFELQEGAMEALCVEAWDWDLVSRND
F
LGK
VVIDVQRLRVVQQEEGWFRLQPDQSKSRRHDEGNLGSLQLEVRLRDETVLPSSYYQPLVHLLCHEV
K
LGMQ
GPGQLIPLIEETTSTECRQDVATNLLKLFLGQGLAKDFLDLLFQLELSRTSETNTLFRSNSLASK
S
VESFLK
VAGMQYLHGVLGPIINKVFEEKKYVELDPSKVEVKDVGCSGLHRPQTEAEVLEQSAQTLRAHL
G
ALLSALSRSVRACPAVVRATFRQLFRRVRERFPGAQHE
NVPFIAVTSFLCLRFFSPAIMSPKLFHLRER
H
ADARTSRTLLLLAK
AVQNVGNMDTPASRAKEAWMEPLQPTVHQGVAQLKDFITKLVDIEEKDELDLQRT
L
SLQAPPVKEGPLFIHRTKGKGPLMSSSFKKLYFSLTTEALSFAKTPSSK
CVNELNQWLSALRKVSINNT
G
LLGSYHPGVFRGDKWSCCHQKEKT
GQGCDKTRSRVTLQEWNDPLDHDLEAQLIYRHLLGVEAMLWERHR
E
LSGGAEAGTVPTSPGK
VPEDSLARLLRVLQDLREAHSSSPAGSPPSEPNCLLELQT



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser