NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS10413.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
10413.1 Public Homo sapiens 16 RAB40C 22 109 92 CCDS HistoryNCBI Gene:57799Re-query CCDS DB by CCDS ID:10413.1Re-query CCDS DB by GeneID:57799See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 10413.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000248139.7 ENSP00000248139.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000248139.7Link to Ensembl Protein Viewer:ENSP00000248139.3Re-query CCDS DB by Nucleotide ID:ENST00000248139Re-query CCDS DB by Protein ID:ENSP00000248139
Original member Current member EBI,WTSI ENST00000538492.5 ENSP00000438382.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000538492.5Link to Ensembl Protein Viewer:ENSP00000438382.1Re-query CCDS DB by Nucleotide ID:ENST00000538492Re-query CCDS DB by Protein ID:ENSP00000438382
Original member Current member EBI,WTSI ENST00000535977.5 ENSP00000438492.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000535977.5Link to Ensembl Protein Viewer:ENSP00000438492.1Re-query CCDS DB by Nucleotide ID:ENST00000535977Re-query CCDS DB by Protein ID:ENSP00000438492
Original member Current member EBI,WTSI ENST00000539661.5 ENSP00000445050.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000539661.5Link to Ensembl Protein Viewer:ENSP00000445050.1Re-query CCDS DB by Nucleotide ID:ENST00000539661Re-query CCDS DB by Protein ID:ENSP00000445050
Original member Current member NCBI NM_001172663.1 NP_001166134.1 Accepted alive Link to Nucleotide Sequence:NM_001172663.1Link to Protein Sequence:NP_001166134.1Re-query CCDS DB by Nucleotide ID:NM_001172663Re-query CCDS DB by Protein ID:NP_001166134Link to BLAST:NP_001166134.1
Original member Current member NCBI NM_001172664.1 NP_001166135.1 Accepted alive Link to Nucleotide Sequence:NM_001172664.1Link to Protein Sequence:NP_001166135.1Re-query CCDS DB by Nucleotide ID:NM_001172664Re-query CCDS DB by Protein ID:NP_001166135Link to BLAST:NP_001166135.1
Original member Current member NCBI NM_001172665.1 NP_001166136.1 Accepted alive Link to Nucleotide Sequence:NM_001172665.1Link to Protein Sequence:NP_001166136.1Re-query CCDS DB by Nucleotide ID:NM_001172665Re-query CCDS DB by Protein ID:NP_001166136Link to BLAST:NP_001166136.1
Original member Current member NCBI NM_021168.4 NP_066991.3 Accepted alive Link to Nucleotide Sequence:NM_021168.4Link to Protein Sequence:NP_066991.3Re-query CCDS DB by Nucleotide ID:NM_021168Re-query CCDS DB by Protein ID:NP_066991Link to BLAST:NP_066991.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001166134.1 281 Q96S21-1 281 100% 0 0
NP_001166135.1 281 Q96S21-1 281 100% 0 0
NP_001166136.1 281 Q96S21-1 281 100% 0 0
NP_066991.3 281 Q96S21-1 281 100% 0 0

Chromosomal Locations for CCDS 10413.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 16 (NC_000016.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 590292 590433 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 617208 617268 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 618200 618260 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 625432 625509 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 625899 626121 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 627342 627622 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (846 nt):
ATGGGCTCGCAGGGCAGTCCGGTGAAGAGCTACGACTACCTGCTCAAGTTCCTGCTGGTGGGCGACAGCG
AC
GTGGGCAAGGGCGAGATCCTGGAGAGCCTGCAGGACGGCGCGGCAGAGTCCCCGTACGCCTACAGTAA
C
GGGATCGACTACAAGACCACCACCATCCTGCTGGACGGCCGGCGCGTGAAGCTGGAGCTCTGGGACACG
TCG
GGCCAGGGCCGGTTCTGCACCATCTTCAGGTCCTACTCCAGGGGCGCTCAGGGGATCCTCTTGGTGT
AT
GACATCACCAACCGCTGGTCCTTTGACGGCATCGACCGCTGGATCAAGGAGATCGATGAGCATGCACC
C
GGAGTCCCCCGGATCTTGGTTGGAAACCGGCTGCACCTGGCCTTCAAGCGGCAGGTCCCGACGGAGCAG
GCC
CGCGCGTACGCAGAGAAGAACTGCATGACCTTCTTTGAGGTCAGCCCCCTGTGCAACTTCAACGTCA
TC
GAGTCCTTCACGGAGCTATCCCGCATCGTGCTCATGCGGCACGGCATGGAGAAGATCTGGAGGCCCAA
C
CGAGTGTTCAGCCTGCAGGACCTCTGCTGCCGGGCCATCGTCTCCTGCACCCCCGTGCACCTCATCGAC
AAG
CTTCCACTGCCCGTCACCATCAAGAGCCACCTCAAGTCCTTCTCGATGGCCAACGGCATGAACGCGG
TC
ATGATGCACGGCCGTTCCTACTCCCTGGCCAGCGGGGCCGGGGGCGGCGGCAGCAAGGGCAACAGCCT
C
AAGAGGTCCAAGTCCATCCGTCCACCCCAGAGCCCCCCCCAGAACTGCTCGCGGAGTAACTGCAAGATC
TCC
TAG


Translation (281 aa):
MGSQGSPVKSYDYLLKFLLVGDSDVGKGEILESLQDGAAESPYAYSNGIDYKTTTILLDGRRVKLELWDT
S
GQGRFCTIFRSYSRGAQ
GILLVYDITNRWSFDGIDRWIKEIDEHAPGVPRILVGNRLHLAFKRQVPTEQ
A
RAYAEKNCMTFFEVSPLCNFNVIESFTELSRIVLMRHGMEKIWRPNR
VFSLQDLCCRAIVSCTPVHLID
K
LPLPVTIKSHLKSFSMANGMNAVMMHGRSYSLASGAGGGGSKGNSLKRSKSIRPPQSPPQNCSRSNCKI
S




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser