NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS4255.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
4255.1 Public Homo sapiens 5 PCDHB13 22 109 92 CCDS HistoryNCBI Gene:56123Re-query CCDS DB by CCDS ID:4255.1Re-query CCDS DB by GeneID:56123See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 4255.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000341948.6 ENSP00000345491.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000341948.6Link to Ensembl Protein Viewer:ENSP00000345491.4Re-query CCDS DB by Nucleotide ID:ENST00000341948Re-query CCDS DB by Protein ID:ENSP00000345491
Original member NCBI NM_018933.3 NP_061756.1 Updated not alive Link to Nucleotide Sequence:NM_018933.3Link to Protein Sequence:NP_061756.1Re-query CCDS DB by Nucleotide ID:NM_018933Re-query CCDS DB by Protein ID:NP_061756
Current member NCBI NM_018933.4 NP_061756.1 Accepted alive Link to Nucleotide Sequence:NM_018933.4Link to Protein Sequence:NP_061756.1Re-query CCDS DB by Nucleotide ID:NM_018933Re-query CCDS DB by Protein ID:NP_061756Link to BLAST:NP_061756.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_061756.1 798 Q9Y5F0 798 100% 0 0

Chromosomal Locations for CCDS 4255.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 5 (NC_000005.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 141214124 141216520 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2397 nt):
ATGGAGGCCAGCGGGAAGCTCATTTGCAGACAAAGGCAAGTCCTTTTTTCCTTTCTCCTTTTGGGCTTAT
CT
CTGGCGGGCGCGGCGGAACCTAGAAGCTATTCTGTGGTGGAGGAAACTGAGGGCAGCTCCTTTGTCAC
C
AATTTAGCAAAGGACCTGGGTCTGGAGCAGAGGGAATTCTCCAGGCGGGGGGTTAGGGTTGTTTCCAGA
GGG
AACAAACTACATTTGCAGCTCAATCAGGAGACCGCGGATTTGTTGCTAAATGAGAAATTGGACCGTG
AG
GATCTGTGCGGTCACACAGAGCCCTGTGTGCTACGTTTCCAAGTGTTGCTAGAGAGTCCCTTCGAGTT
T
TTTCAAGCTGAGCTGCAAGTAATAGACATAAACGACCACTCTCCAGTATTTCTGGACAAACAAATGTTG
GTG
AAAGTATCAGAGAGCAGTCCTCCTGGGACTACGTTTCCTCTGAAGAATGCCGAAGACTTAGATGTAG
GC
CAAAACAATATTGAGAACTATATAATCAGCCCCAACTCCTATTTTCGGGTCCTCACCCGCAAACGCAG
T
GATGGCAGGAAATACCCAGAGCTGGTGCTGGACAAAGCGCTGGACCGAGAGGAAGAAGCTGAGCTCAGG
TTA
ACACTCACAGCACTGGATGGTGGCTCTCCGCCCAGATCTGGCACTGCTCAGGTCTACATCGAAGTCC
TG
GATGTCAACGATAATGCCCCTGAATTTGAGCAGCCTTTCTATAGAGTGCAGATCTCTGAGGACAGTCC
G
GTAGGCTTCCTGGTTGTGAAGGTCTCTGCCACGGATGTAGACACAGGAGTCAACGGAGAGATTTCCTAT
TCA
CTTTTCCAAGCTTCAGAAGAGATTGGCAAAACCTTTAAGATCAATCCCTTGACAGGAGAAATTGAAC
TA
AAAAAACAACTCGATTTCGAAAAACTTCAGTCCTATGAAGTCAATATTGAGGCAAGAGATGCTGGAAC
C
TTTTCTGGAAAATGCACCGTTCTGATTCAAGTGATAGATGTGAACGACCATGCCCCAGAAGTTACCATG
TCT
GCATTTACCAGCCCAATACCTGAGAACGCGCCTGAAACTGTGGTTGCACTTTTCAGTGTTTCAGATC
TT
GATTCAGGAGAAAATGGGAAAATTAGTTGCTCCATTCAGGAGGATCTACCCTTCCTCCTGAAATCCGC
G
GAAAACTTTTACACCCTACTAACGGAGAGACCACTAGACAGAGAAAGCAGAGCGGAATACAACATCACT
ATC
ACTGTCACTGACTTGGGGACCCCTATGCTGATAACACAGCTCAATATGACCGTGCTGATCGCCGATG
TC
AATGACAACGCTCCCGCCTTCACCCAAACCTCCTACACCCTGTTCGTCCGCGAGAACAACAGCCCCGC
C
CTGCACATCCGCAGCGTCAGCGCTACAGACAGAGACTCAGGCACCAACGCCCAGGTCACCTACTCGCTG
CTG
CCGCCCCAGGACCCGCACCTGCCCCTCACATCCCTGGTCTCCATCAACGCGGACAACGGCCACCTGT
TC
GCCCTCAGGTCTCTGGACTACGAGGCCCTGCAGGGGTTCCAGTTCCGCGTGGGCGCTTCAGACCACGG
C
TCCCCGGCGCTGAGCAGCGAGGCGCTGGTGCGCGTGGTGGTGCTGGACGCCAACGACAACTCGCCCTTC
GTG
CTGTACCCGCTGCAGAACGGCTCCGCGCCCTGCACCGAGCTGGTGCCCCGGGCGGCCGAGCCGGGCT
AC
CTGGTGACCAAGGTGGTGGCGGTGGACGGCGACTCGGGCCAGAACGCCTGGCTGTCGTACCAGCTGCT
C
AAGGCCACGGAGCTCGGTCTGTTCGGCGTGTGGGCGCACAATGGCGAGGTGCGCACCGCCAGGCTGCTG
AGC
GAGCGCGACGCGGCCAAGCACAGGCTGGTGGTGCTGGTCAAGGACAATGGCGAGCCTCCGCGCTCGG
CC
ACCGCCACGCTGCACGTGCTCCTGGTGGACGGCTTCTCCCAGCCCTACCTGCCTCTCCCGGAGGCGGC
C
CCGACCCAGGCCCAGGCCGACTTGCTCACCGTCTACCTGGTGGTGGCGTTGGCCTCGGTGTCTTCGCTC
TTC
CTCTTTTCGGTGCTCCTGTTCGTGGCGGTGCGGCTGTGTAGGAGGAGCAGGGCGGCCTCGGTGGGTC
GC
TGCTTGGTGCCCGAGGGCCCCCTTCCAGGGCATCTTGTGGACATGAGCGGCACCAGGACCCTATCCCA
G
AGCTACCAGTATGAGGTGTGTCTGGCAGGAGGCTCAGGGACCAATGAGTTCAAGTTCCTGAAGCCGATT
ATC
CCCAACTTCCCTCCCCAGTGCCCTGGGAAAGAAATACAAGGAAATTCTACCTTCCCCAATAACTTTG
GG
TTCAATATTCAGTGA


Translation (798 aa):
MEASGKLICRQRQVLFSFLLLGLSLAGAAEPRSYSVVEETEGSSFVTNLAKDLGLEQREFSRRGVRVVSR
G
NKLHLQLNQETADLLLNEKLDREDLCGHTEPCVLRFQVLLESPFEFFQAELQVIDINDHSPVFLDKQML
V
KVSESSPPGTTFPLKNAEDLDVGQNNIENYIISPNSYFRVLTRKRSDGRKYPELVLDKALDREEEAELR
L
TLTALDGGSPPRSGTAQVYIEVLDVNDNAPEFEQPFYRVQISEDSPVGFLVVKVSATDVDTGVNGEISY
S
LFQASEEIGKTFKINPLTGEIELKKQLDFEKLQSYEVNIEARDAGTFSGKCTVLIQVIDVNDHAPEVTM
S
AFTSPIPENAPETVVALFSVSDLDSGENGKISCSIQEDLPFLLKSAENFYTLLTERPLDRESRAEYNIT
I
TVTDLGTPMLITQLNMTVLIADVNDNAPAFTQTSYTLFVRENNSPALHIRSVSATDRDSGTNAQVTYSL
L
PPQDPHLPLTSLVSINADNGHLFALRSLDYEALQGFQFRVGASDHGSPALSSEALVRVVVLDANDNSPF
V
LYPLQNGSAPCTELVPRAAEPGYLVTKVVAVDGDSGQNAWLSYQLLKATELGLFGVWAHNGEVRTARLL
S
ERDAAKHRLVVLVKDNGEPPRSATATLHVLLVDGFSQPYLPLPEAAPTQAQADLLTVYLVVALASVSSL
F
LFSVLLFVAVRLCRRSRAASVGRCLVPEGPLPGHLVDMSGTRTLSQSYQYEVCLAGGSGTNEFKFLKPI
I
PNFPPQCPGKEIQGNSTFPNNFGFNIQ




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser