NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS14395.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
14395.1 Public Homo sapiens X OTUD6A 22 109 92 CCDS HistoryNCBI Gene:139562Re-query CCDS DB by CCDS ID:14395.1Re-query CCDS DB by GeneID:139562See the combined annotation on chromosome X in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 14395.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000338352.2 ENSP00000339389.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000338352.2Link to Ensembl Protein Viewer:ENSP00000339389.2Re-query CCDS DB by Nucleotide ID:ENST00000338352Re-query CCDS DB by Protein ID:ENSP00000339389
Original member Current member NCBI NM_207320.2 NP_997203.1 Accepted alive Link to Nucleotide Sequence:NM_207320.2Link to Protein Sequence:NP_997203.1Re-query CCDS DB by Nucleotide ID:NM_207320Re-query CCDS DB by Protein ID:NP_997203Link to BLAST:NP_997203.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_997203.1 288 Q7L8S5 288 100% 0 0

Chromosomal Locations for CCDS 14395.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome X (NC_000023.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XSee the combined annotation on chromosome X in Sequence Viewer

Chromosome Start Stop Links
X 70062525 70063391 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (867 nt):
ATGGATGATCCGAAGAGTGAACAGCAGCGCATACTGCGCCGCCACCAACGCGAGAGGCAGGAGCTGCAGG
CC
CAGATCCGGAGCTTAAAAAACTCGGTCCCCAAGACCGACAAGACGAAAAGAAAGCAGTTGCTCCAAGA
C
GTGGCCCGCATGGAGGCCGAGATGGCTCAGAAGCACCGGCAGGAGCTGGAGAAGTTCCAAGACGACAGT
AGC
ATTGAATCTGTCGTCGAAGACCTGGCCAAGATGAATCTGGAAAACCGGCCTCCCCGCTCCTCCAAAG
CC
CACAGAAAGAGAGAAAGAATGGAGTCCGAGGAGAGGGAGCGCCAGGAGAGCATCTTCCAGGCTGAGAT
G
TCGGAGCACCTGGCCGGCTTCAAGCGCGAGGAGGAGGAGAAGCTCGCCGCCATCCTGGGAGCCAGGGGT
CTG
GAGATGAAAGCGATCCCGGCCGACGGCCACTGCATGTACCGCGCCATCCAAGACCAGCTGGTGTTCA
GC
GTGTCTGTGGAGATGCTGCGCTGCCGCACCGCCAGCTACATGAAGAAGCACGTCGACGAGTTCCTGCC
C
TTCTTCAGCAACCCCGAGACCAGCGACTCCTTCGGCTACGACGACTTCATGATCTACTGCGACAACATC
GTG
CGCACCACGGCATGGGGAGGCCAGCTGGAGCTGAGGGCCCTGTCGCACGTCCTGAAGACCCCCATCG
AG
GTGATCCAGGCCGACTCGCCCACCTTGATCATCGGGGAGGAGTACGTCAAGAAGCCGATCATCCTGGT
C
TACCTGCGCTATGCCTACAGCCTCGGCGAGCACTACAACTCCGTGACACCGCTCGAGGCCGGCGCCGCC
GGG
GGCGTGCTCCCGCGTCTCCTGTAG


Translation (288 aa):
MDDPKSEQQRILRRHQRERQELQAQIRSLKNSVPKTDKTKRKQLLQDVARMEAEMAQKHRQELEKFQDDS
S
IESVVEDLAKMNLENRPPRSSKAHRKRERMESEERERQESIFQAEMSEHLAGFKREEEEKLAAILGARG
L
EMKAIPADGHCMYRAIQDQLVFSVSVEMLRCRTASYMKKHVDEFLPFFSNPETSDSFGYDDFMIYCDNI
V
RTTAWGGQLELRALSHVLKTPIEVIQADSPTLIIGEEYVKKPIILVYLRYAYSLGEHYNSVTPLEAGAA
G
GVLPRLL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser