NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS31704.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
31704.1 Public Homo sapiens 11 OR10G8 22 109 92 CCDS HistoryNCBI Gene:219869Re-query CCDS DB by CCDS ID:31704.1Re-query CCDS DB by GeneID:219869See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 31704.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000431524.1 ENSP00000389072.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000431524.1Link to Ensembl Protein Viewer:ENSP00000389072.1Re-query CCDS DB by Nucleotide ID:ENST00000431524Re-query CCDS DB by Protein ID:ENSP00000389072
Original member Current member EBI,WTSI ENST00000641224.1 ENSP00000493087.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000641224.1Link to Ensembl Protein Viewer:ENSP00000493087.1Re-query CCDS DB by Nucleotide ID:ENST00000641224Re-query CCDS DB by Protein ID:ENSP00000493087
Original member Current member NCBI NM_001004464.1 NP_001004464.1 Accepted alive Link to Nucleotide Sequence:NM_001004464.1Link to Protein Sequence:NP_001004464.1Re-query CCDS DB by Nucleotide ID:NM_001004464Re-query CCDS DB by Protein ID:NP_001004464Link to BLAST:NP_001004464.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001004464.1 311 Q8NGN5 311 100% 0 0

Chromosomal Locations for CCDS 31704.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 11 (NC_000011.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 124029623 124030558 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (936 nt):
ATGTCCAACGCCAGCCTACTGACAGCGTTCATCCTCATGGGCCTTCCCCATGCCCCAGCGCTGGACGCCC
CC
CTCTTTGGAGTCTTCCTGGTGGTTTACGTGCTCACTGTGCTGGGGAACCTCCTCATCCTGCTGGTGAT
C
AGGGTGGATTCTCACCTCCACACCACCATGTACTACTTCCTCACCAACCTGTCGTTCATTGACATGTGG
TTC
TCCACTGTCACGGTGCCCAAATTGCTGATGACTTTGGTGTTCCCAAGTGGCAGGGCTATCTCCTTCC
AC
AGCTGCATGGCTCAGCTCTATTTCTTTCACTTCCTAGGGGGCACCGAGTGTTTCCTCTACAGGGTCAT
G
TCCTGTGATCGCTACCTGGCCATCAGTTACCCGCTCAGGTACACCAGCATGATGACTGGGCGCTCGTGT
ACT
CTTCTGGCCACCAGCACTTGGCTCAGTGGCTCTCTGCACTCTGCTGTCCAGGCCATATTGACTTTCC
AT
TTGCCCTACTGTGGACCCAACTGGATCCAGCACTATTTGTGTGATGCACCGCCCATCCTGAAACTGGC
C
TGTGCAGACACCTCAGCCATAGAGACTGTCATTTTTGTGACTGTTGGAATAGTGGCCTCGGGCTGCTTT
GTC
CTGATAGTGCTGTCCTATGTGTCCATCGTCTGTTCCATCCTGCGGATCCGCACCTCAGAGGGGAAGC
AC
AGAGCCTTTCAGACCTGTGCCTCCCACTGTATCGTGGTCCTTTGCTTCTTTGGCCCTGGTCTTTTCAT
T
TACCTGAGGCCAGGCTCCAGGAAAGCTGTGGATGGAGTTGTGGCCGTTTTCTACACTGTGCTGACGCCC
CTT
CTCAACCCTGTTGTGTACACCCTGAGGAACAAGGAGGTGAAGAAAGCTCTGTTGAAGCTGAAAGACA
AA
GTAGCACATTCTCAGAGCAAATAG


Translation (311 aa):
MSNASLLTAFILMGLPHAPALDAPLFGVFLVVYVLTVLGNLLILLVIRVDSHLHTTMYYFLTNLSFIDMW
F
STVTVPKLLMTLVFPSGRAISFHSCMAQLYFFHFLGGTECFLYRVMSCDRYLAISYPLRYTSMMTGRSC
T
LLATSTWLSGSLHSAVQAILTFHLPYCGPNWIQHYLCDAPPILKLACADTSAIETVIFVTVGIVASGCF
V
LIVLSYVSIVCSILRIRTSEGKHRAFQTCASHCIVVLCFFGPGLFIYLRPGSRKAVDGVVAVFYTVLTP
L
LNPVVYTLRNKEVKKALLKLKDKVAHSQSK




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser