NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS53621.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
53621.1 Public Homo sapiens 11 MYBPC3 20 108 85 CCDS HistoryNCBI Gene:4607Re-query CCDS DB by CCDS ID:53621.1Re-query CCDS DB by GeneID:4607See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 8, NCBI annotation release 37.2, Ensembl annotation release 62

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 53621.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000545968 ENSP00000442795 Accepted alive Link to Ensembl Transcript Viewer:ENST00000545968Link to Ensembl Protein Viewer:ENSP00000442795Re-query CCDS DB by Nucleotide ID:ENST00000545968Re-query CCDS DB by Protein ID:ENSP00000442795
Original member Current member EBI,WTSI OTTHUMT00000392271 OTTHUMP00000234664 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000392271Link to Vega Protein Viewer:OTTHUMP00000234664Re-query CCDS DB by Nucleotide ID:OTTHUMT00000392271Re-query CCDS DB by Protein ID:OTTHUMP00000234664
Original member Current member NCBI NM_000256.3 NP_000247.2 Accepted alive Link to Nucleotide Sequence:NM_000256.3Link to Protein Sequence:NP_000247.2Re-query CCDS DB by Nucleotide ID:NM_000256Re-query CCDS DB by Protein ID:NP_000247Link to BLink:NP_000247.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000247.2 1274 Q14896-1 1274 100% 0 0

Chromosomal Locations for CCDS 53621.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '-' strand of Chromosome 11 (NC_000011.10)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 11Link to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 47331871 47331881 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 47332072 47332258 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 47332566 47332702 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 47332814 47332973 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 47333194 47333333 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 47333557 47333752 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 47333922 47334010 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 47335042 47335209 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 47335877 47336011 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 47337391 47337579 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 47337690 47337794 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 47338520 47338679 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 47339324 47339404 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 47339651 47339790 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 47341003 47341032 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 47341138 47341244 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 47341991 47342156 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 47342578 47342744 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 47342830 47342935 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 47343021 47343145 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 47343260 47343262 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 47343492 47343624 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 47346207 47346370 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 47346627 47346644 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 47347027 47347029 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 47347426 47347479 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 47347651 47347680 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 47347857 47347905 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 47348424 47348541 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 47349774 47349922 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 47350014 47350112 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 47350502 47350615 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 47351239 47351505 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 47352623 47352647 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3825 nt):
ATGCCTGAGCCGGGGAAGAAGCCAGTCTCAGCTTTTAGCAAGAAGCCACGGTCAGTGGAAGTGGCCGCAG
GC
AGCCCTGCCGTGTTCGAGGCCGAGACAGAGCGGGCAGGAGTGAAGGTGCGCTGGCAGCGCGGAGGCAG
T
GACATCAGCGCCAGCAACAAGTACGGCCTGGCCACAGAGGGCACACGGCATACGCTGACAGTGCGGGAA
GTG
GGCCCTGCCGACCAGGGATCTTACGCAGTCATTGCTGGCTCCTCCAAGGTCAAGTTCGACCTCAAGG
TC
ATAGAGGCAGAGAAGGCAGAGCCCATGCTGGCCCCTGCCCCTGCCCCTGCTGAGGCCACTGGAGCCCC
T
GGAGAAGCCCCGGCCCCAGCCGCTGAGCTGGGAGAAAGTGCCCCAAGTCCCAAAGGGTCAAGCTCAGCA
GCT
CTCAATGGTCCTACCCCTGGAGCCCCCGATGACCCCATTGGCCTCTTCGTGATGCGGCCACAGGATG
GC
GAGGTGACCGTGGGTGGCAGCATCACCTTCTCAGCCCGCGTGGCCGGCGCCAGCCTCCTGAAGCCGCC
T
GTGGTCAAGTGGTTCAAGGGCAAATGGGTGGACCTGAGCAGCAAGGTGGGCCAGCACCTGCAGCTGCAC
GAC
AGCTACGACCGCGCCAGCAAGGTCTATCTGTTCGAGCTGCACATCACCGATGCCCAGCCTGCCTTCA
CT
GGCAGCTACCGCTGTGAGGTGTCCACCAAGGACAAATTTGACTGCTCCAACTTCAATCTCACTGTCCA
C
GAGGCCATGGGCACCGGAGACCTGGACCTCCTATCAGCCTTCCGCCGCACGAGCCTGGCTGGAGGTGGT
CGG
CGGATCAGTGATAGCCATGAGGACACTGGGATTCTGGACTTCAGCTCACTGCTGAAAAAGAGAGACA
GT
TTCCGGACCCCGAGGGACTCGAAGCTGGAGGCACCAGCAGAGGAGGACGTGTGGGAGATCCTACGGCA
G
GCACCCCCATCTGAGTACGAGCGCATCGCCTTCCAGTACGGCGTCACTGACCTGCGCGGCATGCTAAAG
AGG
CTCAAGGGCATGAGGCGCGATGAGAAGAAGAGCACAGCCTTTCAGAAGAAGCTGGAGCCGGCCTACC
AG
GTGAGCAAAGGCCACAAGATCCGGCTGACCGTGGAACTGGCTGACCATGACGCTGAGGTCAAATGGCT
C
AAGAATGGCCAGGAGATCCAGATGAGCGGCAGCAAGTACATCTTTGAGTCCATCGGTGCCAAGCGTACC
CTG
ACCATCAGCCAGTGCTCATTGGCGGACGACGCAGCCTACCAGTGCGTGGTGGGTGGCGAGAAGTGTA
GC
ACGGAGCTCTTTGTGAAAGAGCCCCCTGTGCTCATCACGCGCCCCTTGGAGGACCAGCTGGTGATGGT
G
GGGCAGCGGGTGGAGTTTGAGTGTGAAGTATCGGAGGAGGGGGCGCAAGTCAAATGGCTGAAGGACGGG
GTG
GAGCTGACCCGGGAGGAGACCTTCAAATACCGGTTCAAGAAGGACGGGCAGAGACACCACCTGATCA
TC
AACGAGGCCATGCTGGAGGACGCGGGGCACTATGCACTGTGCACTAGCGGGGGCCAGGCGCTGGCTGA
G
CTCATTGTGCAGGAAAAGAAGCTGGAGGTGTACCAGAGCATCGCAGACCTGATGGTGGGCGCAAAGGAC
CAG
GCGGTGTTCAAATGTGAGGTCTCAGATGAGAATGTTCGGGGTGTGTGGCTGAAGAATGGGAAGGAGC
TG
GTGCCCGACAGCCGCATAAAGGTGTCCCACATCGGGCGGGTCCACAAACTGACCATTGACGACGTCAC
A
CCTGCCGACGAGGCTGACTACAGCTTTGTGCCCGAGGGCTTCGCCTGCAACCTGTCAGCCAAGCTCCAC
TTC
ATGGAGGTCAAGATTGACTTCGTACCCAGGCAGGAACCTCCCAAGATCCACCTGGACTGCCCAGGCC
GC
ATACCAGACACCATTGTGGTTGTAGCTGGAAATAAGCTACGTCTGGACGTCCCTATCTCTGGGGACCC
T
GCTCCCACTGTGATCTGGCAGAAGGCTATCACGCAGGGGAATAAGGCCCCAGCCAGGCCAGCCCCAGAT
GCC
CCAGAGGACACAGGTGACAGCGATGAGTGGGTGTTTGACAAGAAGCTGCTGTGTGAGACCGAGGGCC
GG
GTCCGCGTGGAGACCACCAAGGACCGCAGCATCTTCACGGTCGAGGGGGCAGAGAAGGAAGATGAGGG
C
GTCTACACGGTCACAGTGAAGAACCCTGTGGGCGAGGACCAGGTCAACCTCACAGTCAAGGTCATCGAC
GTG
CCAGACGCACCTGCGGCCCCCAAGATCAGCAACGTGGGAGAGGACTCCTGCACAGTACAGTGGGAGC
CG
CCTGCCTACGATGGCGGGCAGCCCATCCTGGGCTACATCCTGGAGCGCAAGAAGAAGAAGAGCTACCG
G
TGGATGCGGCTGAACTTCGACCTGATTCAGGAGCTGAGTCATGAAGCGCGGCGCATGATCGAGGGCGTG
GTG
TACGAGATGCGCGTCTACGCGGTCAACGCCATCGGCATGTCCAGGCCCAGCCCTGCCTCCCAGCCCT
TC
ATGCCTATCGGTCCCCCCAGCGAACCCACCCACCTGGCAGTAGAGGACGTCTCTGACACCACGGTCTC
C
CTCAAGTGGCGGCCCCCAGAGCGCGTGGGAGCAGGAGGCCTGGATGGCTACAGCGTGGAGTACTGCCCA
GAG
GGCTGCTCAGAGTGGGTGGCTGCCCTGCAGGGGCTGACAGAGCACACATCGATACTGGTGAAGGACC
TG
CCCACGGGGGCCCGGCTGCTTTTCCGAGTGCGGGCACACAATATGGCAGGGCCTGGAGCCCCTGTTAC
C
ACCACGGAGCCGGTGACAGTGCAGGAGATCCTGCAACGGCCACGGCTTCAGCTGCCCAGGCACCTGCGC
CAG
ACCATTCAGAAGAAGGTCGGGGAGCCTGTGAACCTTCTCATCCCTTTCCAGGGCAAGCCCCGGCCTC
AG
GTGACCTGGACCAAAGAGGGGCAGCCCCTGGCAGGCGAGGAGGTGAGCATCCGCAACAGCCCCACAGA
C
ACCATCCTGTTCATCCGGGCCGCTCGCCGCGTGCATTCAGGCACTTACCAGGTGACGGTGCGCATTGAG
AAC
ATGGAGGACAAGGCCACGCTGGTGCTGCAGGTTGTTGACAAGCCAAGTCCTCCCCAGGATCTCCGGG
TG
ACTGACGCCTGGGGTCTTAATGTGGCTCTGGAGTGGAAGCCACCCCAGGATGTCGGCAACACGGAGCT
C
TGGGGGTACACAGTGCAGAAAGCCGACAAGAAGACCATGGAGTGGTTCACCGTCTTGGAGCATTACCGC
CGC
ACCCACTGCGTGGTGCCAGAGCTCATCATTGGCAATGGCTACTACTTCCGCGTCTTCAGCCAGAATA
TG
GTTGGCTTTAGTGACAGAGCGGCCACCACCAAGGAGCCCGTCTTTATCCCCAGACCAGGCATCACCTA
T
GAGCCACCCAACTATAAGGCCCTGGACTTCTCCGAGGCCCCAAGCTTCACCCAGCCCCTGGTGAACCGC
TCG
GTCATCGCGGGCTACACTGCTATGCTCTGCTGTGCTGTCCGGGGTAGCCCCAAGCCCAAGATTTCCT
GG
TTCAAGAATGGCCTGGACCTGGGAGAAGACGCCCGCTTCCGCATGTTCAGCAAGCAGGGAGTGTTGAC
T
CTGGAGATTAGAAAGCCCTGCCCCTTTGACGGGGGCATCTATGTCTGCAGGGCCACCAACTTACAGGGC
GAG
GCACGGTGTGAGTGCCGCCTGGAGGTGCGAGTGCCTCAGTGA


Translation (1274 aa):
MPEPGKKPVSAFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVRE
V
GPADQGSYAVIAGSSKVKFDLKVIEA
EKAEPMLAPAPAPAEATGAPGEAPAPAAELGESAPSPKGSSSA
A
LNGPTPGAPDDPIGLFVMRPQDGEVTV
GGSITFSARVAGASLLKPPVVKWFKGKWVDLSSKVGQHLQLH
D
SYDRASK
VYLFELHITDAQPAFTGSYRCEVSTKDKFDCSNFNLTVHEAMGTGDLDLLSAFRRTSLAGGG
R
RI
SDSHEDTGILDFSSLLKKRDSFRTPRDSKLEAPAEEDVWEILRQAPPSEYERIAFQYGVTDLRGMLK
R
LKGMRRDEKKST
AFQKKLEPAYQVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRT
L
TISQCSLADDAAYQCVVGGEKCSTELFVK
EPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDG
V
ELTREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQ
EKKLEVYQSIADLMVGAKD
Q
AVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIG
RVHKLTIDDVTPADEADYSFVPEGFACNLSAKLH
F
M
EVKIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPD
A
PEDTGDSDEWVFDKK
LLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVID
V
PDAPAAPKISNVGEDSCTVQWEPPAYDGGQPIL
GYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGV
V
YEMRVYAVNAIGMSRPSPASQPFMPI
GPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCP
E
G
CSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLR
Q
TIQKKVGEPVNLLIPFQ
GKPRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIE
N
MEDKATLVLQVV
DKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYR
R
THCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRP
GITYEPPNYKALDFSEAPSFTQPLVNR
S
VIAGYTAMLCCAVRGSPK
PKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQG
E
ARCECRLEVR
VPQ



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser