NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS4124.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
4124.1 Public Homo sapiens 5 LVRN 22 109 92 CCDS HistoryNCBI Gene:206338Re-query CCDS DB by CCDS ID:4124.1Re-query CCDS DB by GeneID:206338See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 4124.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000357872.8 ENSP00000350541.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000357872.8Link to Ensembl Protein Viewer:ENSP00000350541.4Re-query CCDS DB by Nucleotide ID:ENST00000357872Re-query CCDS DB by Protein ID:ENSP00000350541
Original member NCBI NM_173800.4 NP_776161.3 Updated not alive Link to Nucleotide Sequence:NM_173800.4Link to Protein Sequence:NP_776161.3Re-query CCDS DB by Nucleotide ID:NM_173800Re-query CCDS DB by Protein ID:NP_776161
Current member NCBI NM_173800.5 NP_776161.3 Accepted alive Link to Nucleotide Sequence:NM_173800.5Link to Protein Sequence:NP_776161.3Re-query CCDS DB by Nucleotide ID:NM_173800Re-query CCDS DB by Protein ID:NP_776161Link to BLAST:NP_776161.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_776161.3 990 Q6Q4G3-1 990 100% 0 0

Chromosomal Locations for CCDS 4124.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 5 (NC_000005.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 115962618 115963312 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 115983287 115983429 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 115984570 115984709 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 115987813 115987939 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 115992123 115992277 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 115993741 115993854 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 115999762 115999902 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 116000433 116000498 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 116000593 116000658 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 116001067 116001239 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 116002835 116002911 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 116003241 116003380 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 116005912 116005967 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 116010741 116010894 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 116012374 116012468 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 116014420 116014527 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 116015252 116015419 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 116015628 116015765 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 116022391 116022466 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 116025978 116026118 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2973 nt):
ATGGGGCCCCCTTCCAGCTCAGGCTTCTATGTGAGCCGCGCAGTGGCCCTGCTGCTGGCTGGGCTGGTAG
CC
GCCCTCCTGCTGGCGCTGGCCGTACTCGCCGCCTTGTACGGCCACTGCGAGCGCGTCCCACCGTCGGA
G
CTGCCTGGACTCAGGGACTTGGAAGCCGAGTCTTCCCCTCCCCTCAGGCAGAAGCCGACGCCAACCCCG
AAA
CCCAGCAGTGCACGCGAGCTAGCGGTGACGACCACCCCGAGCAACTGGCGACCCCCGGGGCCCTGGG
AC
CAGCTACGCCTGCCGCCCTGGCTCGTGCCGCTGCACTACGATCTGGAGCTGTGGCCGCAGCTGAGGCC
C
GACGAGCTTCCGGCCGGGTCTTTGCCCTTCACTGGCCGCGTGAACATCACGGTGCGCTGCACGGTGGCC
ACC
TCTCGACTGCTGCTGCATAGCCTCTTCCAGGACTGCGAGCGCGCCGAGGTGCGGGGACCCCTTTCCC
CG
GGCACTGGGAACGCCACAGTGGGCCGCGTGCCCGTGGACGACGTGTGGTTCGCGCTGGACACGGAATA
C
ATGGTGCTGGAGCTCAGTGAGCCCCTGAAACCTGGTAGCAGCTACGAGCTGCAGCTTAGCTTCTCGGGC
CTG
GTGAAGGAAGACCTCAGGGAGGGACTCTTCCTCAACGTCTACACCGACCAGGGCGAGCGCAGGGCCC
TG
TTAGCGTCCCAGCTGGAACCAACATTTGCCAGGTATGTTTTCCCTTGTTTTGATGAGCCAGCTCTGAA
G
GCAACTTTTAATATTACAATGATTCATCATCCAAGTTATGTGGCCCTTTCCAACATGCCAAAGCTAGGT
CAG
TCTGAAAAAGAAGATGTGAATGGAAGCAAATGGACTGTTACAACCTTTTCCACTACGCCCCACATGC
CA
ACTTACTTAGTCGCATTTGTTATATGTGACTATGACCACGTCAACAGAACAGAAAGGGGCAAGGAGAT
A
CGCATCTGGGCCCGGAAAGATGCAATTGCAAATGGAAGTGCAGACTTTGCTTTGAACATCACAGGTCCC
ATC
TTCTCTTTTCTGGAGGATTTGTTTAATATCAGTTACTCTCTTCCAAAAACAGATATAATTGCCTTGC
CT
AGTTTTGACAACCATGCAATGGAAAACTGGGGACTAATGATATTTGATGAATCAGGATTGTTGTTGGA
A
CCAAAAGATCAACTGACAGAAAAAAAGACTCTGATCTCCTATGTTGTCTCCCACGAGATTGGACACCAG
TGG
TTTGGAAACTTGGTTACCATGAATTGGTGGAACAATATCTGGCTCAACGAGGGTTTTGCATCTTATT
TT
GAGTTTGAAGTAATTAACTACTTTAATCCTAAACTCCCAAGAAATGAGATCTTTTTTTCTAACATTTT
A
CATAATATCCTCAGAGAAGATCACGCCCTGGTGACTAGAGCTGTGGCCATGAAGGTGGAAAATTTCAAA
ACA
AGTGAAATACAGGAACTCTTTGACATATTTACTTACAGCAAGGGAGCGTCTATGGCCCGGATGCTTT
CT
TGTTTCTTGAATGAGCATTTATTTGTCAGTGCACTCAAGTCATATTTGAAGACATTTTCCTACTCAAA
C
GCTGAGCAAGATGATCTATGGAGGCATTTTCAAATGGCCATAGATGACCAGAGTACAGTTATTTTGCCA
GCA
ACAATAAAAAACATAATGGACAGTTGGACACACCAGAGTGGTTTTCCAGTGATCACTTTAAATGTGT
CT
ACTGGCGTCATGAAACAGGAGCCATTTTATCTTGAAAACATTAAAAATCGGACTCTTCTAACCAGCAA
T
GACACATGGATTGTCCCTATTCTTTGGATAAAAAATGGAACTACACAACCTTTAGTCTGGCTAGATCAA
AGC
AGCAAAGTATTCCCAGAAATGCAAGTTTCAGATTCTGACCATGACTGGGTGATTTTGAATTTGAATA
TG
ACTGGATATTATAGAGTTAATTATGATAAATTAGGTTGGAAGAAACTAAATCAACAACTTGAAAAGGA
T
CCTAAGGCGATTCCTGTTATTCACAGACTGCAGTTGATTGATGATGCCTTTTCCTTGTCTAAAAACAAT
TAT
ATTGAGATTGAAACAGCACTTGAGTTAACCAAGTACCTTGCTGAAGAAGATGAAATTATAGTATGGC
AT
ACAGTCTTGGTAAACTTGGTAACCAGGGATCTTGTTTCTGAGGTGAACATCTATGATATATACTCATT
A
TTAAAGAGGTACCTATTAAAGAGACTTAATTTAATATGGAATATTTATTCAACTATAATTCGTGAAAAT
GTG
TTGGCATTACAAGATGACTACTTAGCTCTAATATCACTGGAAAAACTTTTTGTAACTGCGTGTTGGT
TG
GGCCTTGAAGACTGCCTTCAGCTGTCAAAAGAACTTTTCGCAAAATGGGTGGATCATCCAGAAAATGA
A
ATACCTTATCCAATTAAAGATGTGGTTTTATGTTATGGCATTGCCTTGGGAAGTGATAAAGAGTGGGAC
ATC
TTGTTAAATACTTACACTAATACAACAAACAAAGAAGAAAAGATTCAACTTGCTTATGCAATGAGCT
GC
AGCAAAGACCCATGGATACTTAACAGATATATGGAGTATGCCATCAGCACATCTCCATTCACTTCTAA
T
GAAACAAATATAATTGAGGTTGTGGCTTCATCTGAAGTTGGCCGGTATGTCGCAAAAGACTTCTTAGTC
AAC
AACTGGCAAGCTGTGAGTAAAAGGTATGGAACACAATCATTGATTAATCTAATATATACAATAGGGA
GA
ACCGTAACTACAGATTTACAGATTGTGGAGCTGCAGCAGTTTTTCAGTAACATGTTGGAGGAACACCA
G
AGGATCAGAGTTCATGCCAACTTACAGACAATAAAGAATGAAAATCTGAAAAACAAGAAGCTAAGTGCC
AGG
ATAGCTGCGTGGCTAAGGAGAAACACATAG


Translation (990 aa):
MGPPSSSGFYVSRAVALLLAGLVAALLLALAVLAALYGHCERVPPSELPGLRDLEAESSPPLRQKPTPTP
K
PSSARELAVTTTPSNWRPPGPWDQLRLPPWLVPLHYDLELWPQLRPDELPAGSLPFTGRVNITVRCTVA
T
SRLLLHSLFQDCERAEVRGPLSPGTGNATVGRVPVDDVWFALDTEYMVLELSEPLKPGSSYELQLSFSG
L
VKEDLREGLFLNVYTDQGER
RALLASQLEPTFARYVFPCFDEPALKATFNITMIHHPSYVALSNMPKLG
Q
SEKEDVNGSKWTVTTFSTTPHMPTYLVAFVICDYDHVNRTERGKE
IRIWARKDAIANGSADFALNITGP
I
FSFLEDLFNISYSLPKT
DIIALPSFDNHAMENWGLMIFDESGLLLEPKDQLTEKKTLISYVVSHEIGHQ
W
FGNLVTMNWWNNIWLNEGFASYFEFEVINYFNPKLPR
NEIFFSNILHNILREDHALVTRAVAMKVENFK
T
SEIQELFDIFTYSK
GASMARMLSCFLNEHLFVSALKSYLKTFSYSNAEQDDLWRHFQMAIDDQSTVILP
A
TIKNIMDSWTHQSGFPVITLNVSTGVMKQEPFYLENIKNRTLLTS
NDTWIVPILWIKNGTTQPLVWLDQ
S
S
KVFPEMQVSDSDHDWVILNLNMTGYYRVNYDKLGWKKLNQQLEKDPKAIPVIHRLQLIDDAFSLSKNN
Y
IEIETALELTKYLAEEDEIIVWHTVLVNLVTRDLVSEVNIYDIYSLLK
RYLLKRLNLIWNIYSTIIREN
V
LALQDDYLA
LISLEKLFVTACWLGLEDCLQLSKELFAKWVDHPENEIPYPIKDVVLCYGIALGSDKEWD
I
LLNTYTNTTNKEEKIQLAYAMSCSKDPWILN
RYMEYAISTSPFTSNETNIIEVVASSEVGRYVAKDFLV
N
NWQAVSK
RYGTQSLINLIYTIGRTVTTDLQIVELQQFFSNMLEEHQRIRVHANLQTIKNENLKNKKLSA
R
IAAWLRRNT




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser