NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS46892.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
46892.1 Public Homo sapiens 3 LRRC58 22 109 92 CCDS HistoryNCBI Gene:116064Re-query CCDS DB by CCDS ID:46892.1Re-query CCDS DB by GeneID:116064See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 6, NCBI annotation release 37.1, Ensembl annotation release 55

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 46892.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000295628.3 ENSP00000295628.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000295628.3Link to Ensembl Protein Viewer:ENSP00000295628.3Re-query CCDS DB by Nucleotide ID:ENST00000295628Re-query CCDS DB by Protein ID:ENSP00000295628
Original member NCBI NM_001099678.1 NP_001093148.1 Updated not alive Link to Nucleotide Sequence:NM_001099678.1Link to Protein Sequence:NP_001093148.1Re-query CCDS DB by Nucleotide ID:NM_001099678Re-query CCDS DB by Protein ID:NP_001093148
Current member NCBI NM_001099678.2 NP_001093148.1 Accepted alive Link to Nucleotide Sequence:NM_001099678.2Link to Protein Sequence:NP_001093148.1Re-query CCDS DB by Nucleotide ID:NM_001099678Re-query CCDS DB by Protein ID:NP_001093148Link to BLAST:NP_001093148.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001093148.1 371 Q96CX6 371 100% 0 0

Chromosomal Locations for CCDS 46892.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 3 (NC_000003.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 120331200 120331408 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 120334862 120335139 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 120335825 120335953 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 120348744 120349243 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1116 nt):
ATGGAGGAGGCCGGAGCAGCGGTGGTCACGGCCGGGGAGGCCGAACTGAACTGGTCCCGCCTCAGCGTGT
CC
ACCGAGACGCTGGAGTCTGAGCTGGAGGCGCGGGGGGAGGAGCGGCGCGGGGCGCGGGAGGCGCTGCT
G
CGGCTGCTGCTGCCTCACAACCGTCTGGTGTCGCTGCCACGGGCGCTGGGCAGCGGCTTCCCGCACCTC
CAG
CTGCTGGACGTGAGCGGCAACGCGTTGACCGCGCTCGGGCCGGAGCTGCTCGCTCTGCGCGGCCTGC
GC
ACGCTGCTGGCCAAGAACAACCGGCTCGGCGGGCCCAGTGCGCTGCCCAAGGGCCTGGCCCAGTCGCC
G
CTCTGCCGCAGCCTCCAGGTGCTCAACCTCAGCGGCAACTGTTTCCAGGAGGTGCCTGCCTCGCTCTTA
GAG
CTGCGCGCGCTGCAGACCCTGAGCCTGGGCGGCAACCAACTGCAGAGCATCCCGGCTGAGATCGAGA
AC
TTGCAGAGTTTAGAGTGTTTATATCTTGGAGGAAATTTCATTAAAGAAATCCCACCAGAATTAGGAAA
T
CTGCCTTCTCTGAATTATTTGGTATTATGTGACAACAAAATCCAAAGCATACCTCCTCAACTTTCACAG
TTA
CATTCACTTCGTTCCCTAAGTCTTCACAATAACTTGCTGACATATCTGCCTCGAGAGATCCTCAACC
TT
ATTCATTTGGAAGAGTTGAGTTTACGAGGAAATCCATTGGTTGTTCGTTTTGTTAGAGATTTAACCTA
T
GATCCTCCAACTCTCCTGGAATTAGCTGCACGGACCATTAAGATTCGAAATATTTCCTACACTCCCTAT
GAT
CTTCCTGGAAATCTTCTTAGATACTTGGGTTCAGCCAGCAATTGCCCAAACCCAAAGTGTGGAGGAG
TC
TACTTTGACTGCTGTGTCAGACAAATTAAATTTGTGGACTTCTGTGGGAAGTATCGCCTCCCACTGAT
G
CACTACTTGTGTTCACCAGAATGTTCTTCCCCTTGCAGTTCTGCCTCTCACAGCTCCACTTCCCAGAGT
GAA
TCTGACTCAGAAGATGAAGCTAGTGTTGCTGCACGCAGAATGCAGAAAGTTCTTCTTGGTTGA


Translation (371 aa):
MEEAGAAVVTAGEAELNWSRLSVSTETLESELEARGEERRGAREALLRLLLPHNRLVSLPRALGSGFPHL
Q
LLDVSGNALTALGPELLALRGLRTLLAKNNRLGGPSALPKGLAQSPLCRSLQVLNLSGNCFQEVPASLL
E
LRALQTLSLGGNQLQSIPAEIENLQ
SLECLYLGGNFIKEIPPELGNLPSLNYLVLCDNKIQSIPPQLSQ
L
HSLRSLSLHNNLLTYLPREILNLIHLEELSLRGNPLVVRFVRDLTYDPPTLLELAARTIKIRNISYTPY
D
LPGNLLRYLGSASNCPNPKCG
GVYFDCCVRQIKFVDFCGKYRLPLMHYLCSPECSSPCSSASHSSTSQS
E
SDSEDEASVAARRMQKVLLG




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser