NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS9410.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
9410.1 Public Homo sapiens 13 LPAR6 20 108 85 CCDS HistoryNCBI Gene:10161Re-query CCDS DB by CCDS ID:9410.1Re-query CCDS DB by GeneID:10161See the combined annotation on chromosome 13 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 9410.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000345941 ENSP00000344353 Accepted alive Link to Ensembl Transcript Viewer:ENST00000345941Link to Ensembl Protein Viewer:ENSP00000344353Re-query CCDS DB by Nucleotide ID:ENST00000345941Re-query CCDS DB by Protein ID:ENSP00000344353
Original member Current member EBI,WTSI ENST00000378434 ENSP00000367691 Accepted alive Link to Ensembl Transcript Viewer:ENST00000378434Link to Ensembl Protein Viewer:ENSP00000367691Re-query CCDS DB by Nucleotide ID:ENST00000378434Re-query CCDS DB by Protein ID:ENSP00000367691
Original member Current member EBI,WTSI ENST00000620633 ENSP00000482660 Accepted alive Link to Ensembl Transcript Viewer:ENST00000620633Link to Ensembl Protein Viewer:ENSP00000482660Re-query CCDS DB by Nucleotide ID:ENST00000620633Re-query CCDS DB by Protein ID:ENSP00000482660
Original member Current member EBI,WTSI OTTHUMT00000044873 OTTHUMP00000018396 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000044873Link to Vega Protein Viewer:OTTHUMP00000018396Re-query CCDS DB by Nucleotide ID:OTTHUMT00000044873Re-query CCDS DB by Protein ID:OTTHUMP00000018396
Original member Current member EBI,WTSI OTTHUMT00000276280 OTTHUMP00000178634 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000276280Link to Vega Protein Viewer:OTTHUMP00000178634Re-query CCDS DB by Nucleotide ID:OTTHUMT00000276280Re-query CCDS DB by Protein ID:OTTHUMP00000178634
Original member Current member NCBI NM_001162497.1 NP_001155969.1 Accepted alive Link to Nucleotide Sequence:NM_001162497.1Link to Protein Sequence:NP_001155969.1Re-query CCDS DB by Nucleotide ID:NM_001162497Re-query CCDS DB by Protein ID:NP_001155969Link to BLink:NP_001155969.1
Original member Current member NCBI NM_001162498.1 NP_001155970.1 Accepted alive Link to Nucleotide Sequence:NM_001162498.1Link to Protein Sequence:NP_001155970.1Re-query CCDS DB by Nucleotide ID:NM_001162498Re-query CCDS DB by Protein ID:NP_001155970Link to BLink:NP_001155970.1
Original member Current member NCBI NM_005767.5 NP_005758.2 Accepted alive Link to Nucleotide Sequence:NM_005767.5Link to Protein Sequence:NP_005758.2Re-query CCDS DB by Nucleotide ID:NM_005767Re-query CCDS DB by Protein ID:NP_005758Link to BLink:NP_005758.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001155969.1 344 P43657 344 100% 0 0
NP_001155970.1 344 P43657 344 100% 0 0
NP_005758.2 344 P43657 344 100% 0 0

Chromosomal Locations for CCDS 9410.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '-' strand of Chromosome 13 (NC_000013.11)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 13Link to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13See the combined annotation on chromosome 13 in Sequence Viewer

Chromosome Start Stop Links
13 48411389 48412423 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1035 nt):
ATGGTAAGCGTTAACAGCTCCCACTGCTTCTATAATGACTCCTTTAAGTACACTTTGTATGGGTGCATGT
TC
AGCATGGTGTTTGTGCTTGGGTTAATATCCAATTGTGTTGCCATATACATTTTCATCTGCGTCCTCAA
A
GTCCGAAATGAAACTACAACTTACATGATTAACTTGGCAATGTCAGACTTGCTTTTTGTTTTTACTTTA
CCC
TTCAGGATTTTTTACTTCACAACACGGAATTGGCCATTTGGAGATTTACTTTGTAAGATTTCTGTGA
TG
CTGTTTTATACCAACATGTACGGAAGCATTCTGTTCTTAACCTGTATTAGTGTAGATCGATTTCTGGC
A
ATTGTCTACCCATTTAAGTCAAAGACTCTAAGAACCAAAAGAAATGCAAAGATTGTTTGCACTGGCGTG
TGG
TTAACTGTGATCGGAGGAAGTGCACCCGCCGTTTTTGTTCAGTCTACCCACTCTCAGGGTAACAATG
CC
TCAGAAGCCTGCTTTGAAAATTTTCCAGAAGCCACATGGAAAACATATCTCTCAAGGATTGTAATTTT
C
ATCGAAATAGTGGGATTTTTTATTCCTCTAATTTTAAATGTAACTTGTTCTAGTATGGTGCTAAAAACT
TTA
ACCAAACCTGTTACATTAAGTAGAAGCAAAATAAACAAAACTAAGGTTTTAAAAATGATTTTTGTAC
AT
TTGATCATATTCTGTTTCTGTTTTGTTCCTTACAATATCAATCTTATTTTATATTCTCTTGTGAGAAC
A
CAAACATTTGTTAATTGCTCAGTAGTGGCAGCAGTAAGGACAATGTACCCAATCACTCTCTGTATTGCT
GTT
TCCAACTGTTGTTTTGACCCTATAGTTTACTACTTTACATCGGACACAATTCAGAATTCAATAAAAA
TG
AAAAACTGGTCTGTCAGGAGAAGTGACTTCAGATTCTCTGAAGTTCATGGTGCAGAGAATTTTATTCA
G
CATAACCTACAGACCTTAAAAAGTAAGATATTTGACAATGAATCTGCTGCCTGA


Translation (344 aa):
MVSVNSSHCFYNDSFKYTLYGCMFSMVFVLGLISNCVAIYIFICVLKVRNETTTYMINLAMSDLLFVFTL
P
FRIFYFTTRNWPFGDLLCKISVMLFYTNMYGSILFLTCISVDRFLAIVYPFKSKTLRTKRNAKIVCTGV
W
LTVIGGSAPAVFVQSTHSQGNNASEACFENFPEATWKTYLSRIVIFIEIVGFFIPLILNVTCSSMVLKT
L
TKPVTLSRSKINKTKVLKMIFVHLIIFCFCFVPYNINLILYSLVRTQTFVNCSVVAAVRTMYPITLCIA
V
SNCCFDPIVYYFTSDTIQNSIKMKNWSVRRSDFRFSEVHGAENFIQHNLQTLKSKIFDNESAA




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser