NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS8836.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
8836.1 Public Homo sapiens 12 KRT1 20 108 85 CCDS HistoryNCBI Gene:3848Re-query CCDS DB by CCDS ID:8836.1Re-query CCDS DB by GeneID:3848See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 8836.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000252244 ENSP00000252244 Accepted alive Link to Ensembl Transcript Viewer:ENST00000252244Link to Ensembl Protein Viewer:ENSP00000252244Re-query CCDS DB by Nucleotide ID:ENST00000252244Re-query CCDS DB by Protein ID:ENSP00000252244
Original member Current member EBI,WTSI OTTHUMT00000405706 OTTHUMP00000241991 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000405706Link to Vega Protein Viewer:OTTHUMP00000241991Re-query CCDS DB by Nucleotide ID:OTTHUMT00000405706Re-query CCDS DB by Protein ID:OTTHUMP00000241991
Original member Current member NCBI NM_006121.3 NP_006112.3 Accepted alive Link to Nucleotide Sequence:NM_006121.3Link to Protein Sequence:NP_006112.3Re-query CCDS DB by Nucleotide ID:NM_006121Re-query CCDS DB by Protein ID:NP_006112Link to BLink:NP_006112.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_006112.3 644 P04264 644 100% 0 0

Chromosomal Locations for CCDS 8836.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '-' strand of Chromosome 12 (NC_000012.12)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 12Link to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 52675193 52675617 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 52675710 52675744 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 52676275 52676495 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 52677059 52677184 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 52677316 52677480 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 52677650 52677745 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 52678163 52678223 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 52678542 52678756 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 52679758 52680348 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1935 nt):
ATGAGTCGACAGTTTAGTTCCAGGTCTGGGTACCGAAGTGGAGGGGGCTTCAGCTCTGGCTCTGCTGGGA
TC
ATCAACTACCAGCGCAGGACCACCAGCAGCTCCACACGCCGCAGTGGAGGAGGTGGTGGGAGATTTTC
A
AGCTGTGGTGGTGGTGGTGGTAGCTTTGGTGCTGGTGGTGGATTTGGAAGTCGGAGTCTTGTTAACCTT
GGT
GGCAGTAAAAGCATCTCCATAAGTGTGGCTAGAGGAGGTGGACGTGGTAGTGGCTTTGGTGGTGGTT
AT
GGTGGTGGTGGCTTTGGTGGTGGTGGCTTTGGTGGTGGTGGCTTTGGTGGAGGTGGCATTGGGGGTGG
T
GGCTTTGGTGGTTTTGGCAGTGGTGGTGGTGGTTTTGGTGGAGGTGGCTTTGGGGGTGGTGGATATGGG
GGT
GGTTATGGTCCTGTCTGCCCTCCTGGTGGCATACAAGAAGTCACTATCAACCAGAGCCTTCTTCAGC
CC
CTCAATGTGGAGATTGACCCTGAGATCCAAAAGGTGAAGTCTCGAGAAAGGGAGCAAATCAAGTCACT
C
AACAACCAATTTGCCTCCTTCATTGACAAGGTGAGGTTCCTGGAGCAGCAGAACCAGGTACTGCAAACA
AAA
TGGGAGCTGCTGCAGCAGGTAGATACCTCCACTAGAACCCATAATTTAGAGCCCTACTTTGAGTCAT
TC
ATCAACAATCTCCGAAGGAGAGTGGACCAACTGAAGAGTGATCAATCTCGGTTGGATTCGGAACTGAA
G
AACATGCAGGACATGGTGGAGGATTACCGGAACAAGTATGAGGATGAAATCAACAAGCGGACAAATGCA
GAG
AATGAATTTGTGACCATCAAGAAGGATGTGGATGGTGCTTATATGACCAAGGTGGACCTTCAGGCCA
AA
CTTGACAACTTGCAGCAGGAAATTGATTTCCTTACAGCACTCTACCAAGCAGAGTTGTCTCAGATGCA
G
ACTCAAATCAGTGAAACTAATGTCATCCTCTCTATGGACAACAACCGCAGTCTCGACCTGGACAGCATC
ATT
GCTGAGGTCAAGGCCCAGTACGAGGATATAGCCCAGAAGAGCAAAGCTGAGGCCGAGTCCTTGTACC
AG
AGCAAGTATGAAGAGCTGCAGATCACTGCTGGCAGACATGGGGATAGTGTGAGAAATTCAAAGATAGA
A
ATTTCTGAGCTGAATCGTGTGATCCAGAGACTTAGATCTGAAATCGACAATGTCAAGAAGCAGATCTCC
AAC
TTGCAGCAGTCCATCAGTGATGCAGAGCAGCGTGGCGAGAATGCCCTCAAGGATGCCAAGAACAAGC
TG
AATGACCTGGAGGATGCCCTGCAGCAGGCCAAGGAAGACCTGGCCCGCCTGCTGCGCGACTACCAGGA
G
CTGATGAACACAAAGCTGGCCCTGGATCTGGAGATTGCCACCTACAGGACCCTCCTGGAGGGAGAAGAA
AGC
AGGATGTCTGGAGAATGTGCCCCGAACGTGAGTGTGTCTGTGAGCACAAGCCACACCACCATCAGTG
GA
GGTGGCAGCCGAGGAGGTGGCGGCGGTGGCTACGGCTCTGGAGGTAGCAGCTATGGCTCCGGAGGTGG
T
AGCTATGGTTCTGGAGGTGGCGGCGGCGGCGGCCGTGGCAGCTATGGCTCCGGAGGTAGCAGCTACGGC
TCC
GGAGGTGGCAGCTATGGCTCTGGAGGTGGCGGCGGCGGCCATGGCAGCTACGGCTCCGGAAGCAGCA
GT
GGGGGCTACAGAGGTGGCTCTGGAGGCGGCGGCGGCGGCAGCTCTGGCGGCCGGGGCTCTGGCGGCGG
G
AGCTCTGGAGGCTCCATAGGAGGCCGGGGATCCAGCTCTGGGGGTGTCAAGTCCTCTGGTGGCAGTTCC
AGC
GTGAAGTTTGTTTCTACCACTTATTCCGGAGTAACCAGATAA


Translation (644 aa):
MSRQFSSRSGYRSGGGFSSGSAGIINYQRRTTSSSTRRSGGGGGRFSSCGGGGGSFGAGGGFGSRSLVNL
G
GSKSISISVARGGGRGSGFGGGYGGGGFGGGGFGGGGFGGGGIGGGGFGGFGSGGGGFGGGGFGGGGYG
G
GYGPVCPPGGIQEVTINQSLLQPLNVEIDPEIQKVKSREREQIKSLNNQFASFIDK
VRFLEQQNQVLQT
K
WELLQQVDTSTRTHNLEPYFESFINNLRRRVDQLKSDQSRLDSELKNMQDMVEDYRN
KYEDEINKRTNA
E
NEFVTIKK
DVDGAYMTKVDLQAKLDNLQQEIDFLTALYQAELSQMQTQISETNVILSMDNNRSLDLDSI
I
AEVKAQYEDIAQKSKAEAESLYQSK
YEELQITAGRHGDSVRNSKIEISELNRVIQRLRSEIDNVKKQIS
N
LQQSISDAEQRGENALKDAKNKLNDLEDALQQAKEDLARLLRDYQELMNTKLALDLEIATYRTLLEGEE
S
RMSGECAPNVSVSVSTSHTTISGGGSRGGGGGGYGSGGSSYGSGGGSYGSGGGGGGGRGSYGSGGSSYG
S
GGGSYGSGGGGGGHGSYGSGSSSGGYRGGSGGGGGGSSGGRGSGGGSSGGSIGGRGSSSGGVKSSGGSS
S
VKFVSTTYSGVTR




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser