NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS12793.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
12793.1 Public Homo sapiens 19 KCNC3 22 109 92 CCDS HistoryNCBI Gene:3748Re-query CCDS DB by CCDS ID:12793.1Re-query CCDS DB by GeneID:3748See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 12793.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000477616.1 ENSP00000434241.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000477616.1Link to Ensembl Protein Viewer:ENSP00000434241.1Re-query CCDS DB by Nucleotide ID:ENST00000477616Re-query CCDS DB by Protein ID:ENSP00000434241
Original member Current member NCBI NM_004977.2 NP_004968.2 Accepted alive Link to Nucleotide Sequence:NM_004977.2Link to Protein Sequence:NP_004968.2Re-query CCDS DB by Nucleotide ID:NM_004977Re-query CCDS DB by Protein ID:NP_004968Link to BLAST:NP_004968.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_004968.2 757 Q14003 757 100% 0 0

Chromosomal Locations for CCDS 12793.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 19 (NC_000019.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 50320246 50320349 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 50320593 50320784 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 50322975 50324082 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 50328213 50329082 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2274 nt):
ATGCTGAGCTCAGTCTGCGTCTCGTCCTTCCGCGGGCGCCAGGGGGCCAGCAAGCAGCAGCCGGCGCCAC
CG
CCGCAGCCGCCCGAGTCCCCGCCGCCGCCACCGCTGCCGCCGCAGCAGCAGCAGCCTGCGCAGCCCGG
C
CCCGCCGCGTCCCCGGCGGGCCCCCCGGCACCCCGCGGGCCCGGGGACCGGCGCGCCGAGCCATGCCCC
GGG
CTGCCGGCGGCGGCCATGGGGCGGCACGGCGGCGGCGGTGGCGACAGCGGCAAGATCGTGATCAACG
TG
GGCGGCGTGCGCCATGAGACGTACCGCTCGACGCTGCGCACCCTGCCGGGGACGCGGCTGGCCGGCCT
G
ACGGAGCCCGAGGCGGCGGCACGCTTCGACTACGACCCGGGCGCCGACGAGTTCTTCTTTGACCGGCAC
CCG
GGAGTCTTCGCGTACGTGCTCAACTACTACCGCACCGGCAAGCTGCACTGCCCAGCCGACGTGTGCG
GG
CCCCTGTTTGAGGAGGAGCTCGGCTTCTGGGGCATCGACGAGACCGACGTGGAGGCCTGCTGCTGGAT
G
ACCTACCGGCAGCATCGCGACGCTGAGGAGGCGCTCGACTCCTTCGAGGCGCCCGACCCCGCGGGCGCC
GCC
AACGCCGCCAACGCCGCAGGCGCCCACGACGGAGGCCTGGACGACGAGGCGGGCGCGGGCGGCGGCG
GC
CTGGACGGAGCGGGCGGCGAGCTCAAGCGCCTCTGCTTCCAGGACGCGGGCGGCGGCGCCGGGGGGCC
G
CCAGGGGGCGCGGGCGGCGCGGGCGGCACATGGTGGCGCCGCTGGCAGCCCCGCGTGTGGGCGCTCTTC
GAG
GACCCCTACTCGTCGCGGGCTGCCAGGTATGTGGCCTTCGCCTCCCTCTTCTTCATCCTCATCTCCA
TC
ACCACCTTCTGCCTGGAAACCCATGAGGGCTTCATCCATATTAGCAACAAGACGGTGACCCAGGCCTC
C
CCGATCCCCGGGGCACCTCCGGAGAACATCACCAACGTGGAGGTGGAGACGGAGCCCTTCCTGACCTAC
GTG
GAGGGGGTGTGCGTGGTCTGGTTCACCTTCGAGTTCCTCATGCGCATCACCTTCTGCCCAGACAAGG
TG
GAGTTTCTTAAAAGCAGCCTCAACATCATCGACTGTGTGGCCATCCTGCCCTTCTATCTCGAGGTGGG
C
CTCTCGGGCCTCAGCTCCAAGGCCGCCAAAGACGTGCTGGGCTTCCTGCGGGTGGTCCGCTTCGTCCGC
ATC
CTGCGCATCTTCAAGCTGACCCGGCACTTCGTGGGGCTGCGCGTGCTGGGACACACGCTCCGCGCCA
GC
ACCAACGAGTTCCTGCTGCTCATCATCTTCCTGGCCCTGGGGGTGCTCATCTTCGCCACCATGATTTA
C
TACGCTGAGCGCATTGGCGCCGACCCCGATGACATCCTGGGCTCCAACCACACCTACTTCAAGAACATC
CCC
ATTGGCTTCTGGTGGGCTGTGGTCACCATGACGACCCTGGGCTATGGAGACATGTACCCCAAGACGT
GG
TCGGGGATGCTGGTCGGGGCGCTGTGTGCCCTGGCGGGGGTGCTGACCATCGCCATGCCTGTGCCCGT
C
ATTGTCAACAACTTTGGCATGTACTATTCGCTGGCCATGGCCAAGCAGAAGCTGCCCAAGAAGAAGAAC
AAA
CACATCCCCCGGCCCCCGCAACCGGGCTCGCCCAACTACTGCAAGCCTGACCCACCCCCGCCACCCC
CG
CCCCACCCGCACCACGGCAGCGGGGGCATCAGCCCGCCGCCACCCATCACCCCACCCTCCATGGGGGT
G
ACTGTGGCCGGGGCCTACCCAGCGGGGCCCCACACGCACCCCGGGCTGCTCAGGGGGGGAGCGGGTGGG
CTG
GGGATCATGGGGCTGCCTCCTCTGCCAGCCCCCGGCGAGCCTTGCCCGTTGGCTCAGGAGGAGGTGA
TT
GAGATCAACCGGGCAGATCCTCGCCCCAATGGGGATCCGGCAGCAGCTGCGCTTGCCCACGAGGACTG
C
CCAGCCATTGACCAGCCTGCCATGTCCCCGGAAGACAAGAGCCCCATCACGCCTGGAAGCCGTGGCCGC
TAT
AGCCGGGACCGAGCCTGCTTCCTCCTCACCGACTATGCCCCTTCCCCTGATGGCTCCATCCGAAAAG
CC
ACTGGTGCTCCCCCACTGCCCCCCCAAGACTGGCGTAAGCCAGGCCCCCCAAGCTTCTTGCCCGACCT
C
AACGCCAACGCCGCGGCCTGGATATCCCCCTAG


Translation (757 aa):
MLSSVCVSSFRGRQGASKQQPAPPPQPPESPPPPPLPPQQQQPAQPGPAASPAGPPAPRGPGDRRAEPCP
G
LPAAAMGRHGGGGGDSGKIVINVGGVRHETYRSTLRTLPGTRLAGLTEPEAAARFDYDPGADEFFFDRH
P
GVFAYVLNYYRTGKLHCPADVCGPLFEEELGFWGIDETDVEACCWMTYRQHRDAEEALDSFEAPDPAGA
A
NAANAAGAHDGGLDDEAGAGGGGLDGAGGELKRLCFQDAGGGAGGPPGGAGGAGGTWWRRWQPRVWALF
E
DPYSSRAAR
YVAFASLFFILISITTFCLETHEGFIHISNKTVTQASPIPGAPPENITNVEVETEPFLTY
V
EGVCVVWFTFEFLMRITFCPDKVEFLKSSLNIIDCVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVR
I
LRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGADPDDILGSNHTYFKNI
P
IGFWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKKN
K
HIPRPPQPGSPNYCKPDPPPPPPPHPHHGSGGISPPPPITPPSMGVTVAGAYPAGPHTHPGLLRGGAGG
L
GIMGLPPLPAPGEPCPLAQEEVIEINRA
DPRPNGDPAAAALAHEDCPAIDQPAMSPEDKSPITPGSRGR
Y
SRDRACFLLTDYAPSPDGSIRK
ATGAPPLPPQDWRKPGPPSFLPDLNANAAAWISP



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser