NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS8925.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
8925.1 Public Homo sapiens 12 HSD17B6 22 109 92 CCDS HistoryNCBI Gene:8630Re-query CCDS DB by CCDS ID:8925.1Re-query CCDS DB by GeneID:8630See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 8925.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000322165.1 ENSP00000318631.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000322165.1Link to Ensembl Protein Viewer:ENSP00000318631.1Re-query CCDS DB by Nucleotide ID:ENST00000322165Re-query CCDS DB by Protein ID:ENSP00000318631
Original member Current member EBI,WTSI ENST00000555159.5 ENSP00000450698.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000555159.5Link to Ensembl Protein Viewer:ENSP00000450698.1Re-query CCDS DB by Nucleotide ID:ENST00000555159Re-query CCDS DB by Protein ID:ENSP00000450698
Original member Current member EBI,WTSI ENST00000554643.5 ENSP00000451406.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000554643.5Link to Ensembl Protein Viewer:ENSP00000451406.1Re-query CCDS DB by Nucleotide ID:ENST00000554643Re-query CCDS DB by Protein ID:ENSP00000451406
Original member Current member EBI,WTSI ENST00000555805.5 ENSP00000451753.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000555805.5Link to Ensembl Protein Viewer:ENSP00000451753.1Re-query CCDS DB by Nucleotide ID:ENST00000555805Re-query CCDS DB by Protein ID:ENSP00000451753
Original member Current member EBI,WTSI ENST00000554150.5 ENSP00000452273.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000554150.5Link to Ensembl Protein Viewer:ENSP00000452273.1Re-query CCDS DB by Nucleotide ID:ENST00000554150Re-query CCDS DB by Protein ID:ENSP00000452273
Original member NCBI NM_003725.3 NP_003716.2 Updated not alive Link to Nucleotide Sequence:NM_003725.3Link to Protein Sequence:NP_003716.2Re-query CCDS DB by Nucleotide ID:NM_003725Re-query CCDS DB by Protein ID:NP_003716
Current member NCBI NM_003725.4 NP_003716.2 Accepted alive Link to Nucleotide Sequence:NM_003725.4Link to Protein Sequence:NP_003716.2Re-query CCDS DB by Nucleotide ID:NM_003725Re-query CCDS DB by Protein ID:NP_003716Link to BLAST:NP_003716.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_003716.2 317 O14756 317 100% 0 0

Chromosomal Locations for CCDS 8925.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 12 (NC_000012.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 56773853 56774165 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 56781974 56782232 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 56784853 56785016 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 56787125 56787342 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (954 nt):
ATGTGGCTCTACCTGGCGGCCTTCGTGGGCCTGTACTACCTTCTGCACTGGTACCGGGAGAGGCAGGTGG
TG
AGCCACCTCCAAGACAAGTATGTCTTTATCACGGGCTGTGACTCGGGCTTTGGGAACCTGCTGGCCAG
A
CAGCTGGATGCACGAGGCTTGAGAGTGCTGGCTGCGTGTCTGACGGAGAAGGGGGCCGAGCAGCTGAGG
GGC
CAGACGTCTGACAGGCTGGAGACGGTGACCCTGGATGTTACCAAGATGGAGAGCATCGCTGCAGCTA
CT
CAGTGGGTGAAGGAGCATGTGGGGGACAGAGGACTCTGGGGACTGGTGAACAATGCAGGCATTCTTAC
A
CCAATTACCTTATGTGAGTGGCTGAACACTGAGGACTCTATGAATATGCTCAAAGTGAACCTCATTGGT
GTG
ATCCAGGTGACCTTGAGCATGCTTCCTTTGGTGAGGAGAGCACGGGGAAGAATTGTCAATGTCTCCA
GC
ATTCTGGGAAGAGTTGCTTTCTTTGTAGGAGGCTACTGTGTCTCCAAGTATGGAGTGGAAGCCTTTTC
A
GATATTCTGAGGCGTGAGATTCAACATTTTGGGGTGAAAATCAGCATAGTTGAACCTGGCTACTTCAGA
ACG
GGAATGACAAACATGACACAGTCCTTAGAGCGAATGAAGCAAAGTTGGAAAGAAGCCCCCAAGCATA
TT
AAGGAGACCTATGGACAGCAGTATTTTGATGCCCTTTACAATATCATGAAGGAAGGGCTGTTGAATTG
T
AGCACAAACCTGAACCTGGTCACTGACTGCATGGAACATGCTCTGACATCGGTGCATCCGCGAACTCGA
TAT
TCAGCTGGCTGGGATGCTAAATTTTTCTTCATCCCTCTATCTTATTTACCTACATCACTGGCAGACT
AC
ATTTTGACTAGATCTTGGCCCAAACCAGCCCAGGCAGTCTAA


Translation (317 aa):
MWLYLAAFVGLYYLLHWYRERQVVSHLQDKYVFITGCDSGFGNLLARQLDARGLRVLAACLTEKGAEQLR
G
QTSDRLETVTLDVTKMESIAAATQWVKEHVGDR
GLWGLVNNAGILTPITLCEWLNTEDSMNMLKVNLIG
V
IQVTLSMLPLVRRARGRIVNVSSILGRVAFFVGGYCVSKYGVEAFSDIL
RREIQHFGVKISIVEPGYFR
T
GMTNMTQSLERMKQSWKEAPKHIKETYGQQYFDA
LYNIMKEGLLNCSTNLNLVTDCMEHALTSVHPRTR
Y
SAGWDAKFFFIPLSYLPTSLADYILTRSWPKPAQAV




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser