NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS9181.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
9181.1 Public Homo sapiens 12 HRK 20 108 85 CCDS HistoryNCBI Gene:8739Re-query CCDS DB by CCDS ID:9181.1Re-query CCDS DB by GeneID:8739See the combined annotation on chromosome 12 in Sequence Viewer

Public Note for CCDS 9181.1
This CCDS ID represents the protein described in PMID: 9130713 and 9228060. This transcript is supported by BF510077.1. It should be noted this transcript is predicted to undergo nonsense-mediated mRNA decay (NMD). However, the protein is represented because it was detected endogenously PMID: 18008329. It is likely that the majority of transcripts representing this variant will undergo NMD, while some low level of NMD escape may allow for the expression of this protein.

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)


Attributes
Nonsense-mediated decay (NMD) candidate

Sequence IDs included in CCDS 9181.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000257572 ENSP00000257572 Accepted alive Link to Ensembl Transcript Viewer:ENST00000257572Link to Ensembl Protein Viewer:ENSP00000257572Re-query CCDS DB by Nucleotide ID:ENST00000257572Re-query CCDS DB by Protein ID:ENSP00000257572
Original member Current member EBI,WTSI OTTHUMT00000403559 OTTHUMP00000240831 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000403559Link to Vega Protein Viewer:OTTHUMP00000240831Re-query CCDS DB by Nucleotide ID:OTTHUMT00000403559Re-query CCDS DB by Protein ID:OTTHUMP00000240831
Original member NCBI NM_003806.2 NP_003797.1 Updated not alive Link to Nucleotide Sequence:NM_003806.2Link to Protein Sequence:NP_003797.1Re-query CCDS DB by Nucleotide ID:NM_003806Re-query CCDS DB by Protein ID:NP_003797
Current member NCBI NM_003806.3 NP_003797.1 Accepted alive Link to Nucleotide Sequence:NM_003806.3Link to Protein Sequence:NP_003797.1Re-query CCDS DB by Nucleotide ID:NM_003806Re-query CCDS DB by Protein ID:NP_003797Link to BLink:NP_003797.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_003797.1 91 O00198 91 100% 0 0

Chromosomal Locations for CCDS 9181.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '-' strand of Chromosome 12 (NC_000012.12)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 12Link to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 116881032 116881307 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (276 nt):
ATGTGCCCGTGCCCCCTGCACCGCGGCCGCGGCCCCCCGGCCGTGTGCGCCTGCAGCGCGGGTCGCCTGG
GG
CTGCGCTCGTCCGCCGCGCAGCTCACCGCCGCCCGGCTCAAGGCGCTAGGCGACGAGCTGCACCAGCG
C
ACCATGTGGCGGCGCCGCGCGCGGAGCCGGAGGGCGCCGGCGCCCGGCGCGCTCCCCACCTACTGGCCT
TGG
CTGTGCGCGGCCGCGCAGGTGGCGGCGCTGGCGGCCTGGCTGCTCGGCAGGCGGAACTTGTAG


Translation (91 aa):
MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWP
W
LCAAAQVAALAAWLLGRRNL




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser