NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS41318.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
41318.1 Public Homo sapiens 1 HECTD3 22 109 92 CCDS HistoryNCBI Gene:79654Re-query CCDS DB by CCDS ID:41318.1Re-query CCDS DB by GeneID:79654See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 5, NCBI annotation release 36.3, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 41318.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000372172.4 ENSP00000361245.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000372172.4Link to Ensembl Protein Viewer:ENSP00000361245.4Re-query CCDS DB by Nucleotide ID:ENST00000372172Re-query CCDS DB by Protein ID:ENSP00000361245
Original member NCBI NM_024602.5 NP_078878.3 Updated not alive Link to Nucleotide Sequence:NM_024602.5Link to Protein Sequence:NP_078878.3Re-query CCDS DB by Nucleotide ID:NM_024602Re-query CCDS DB by Protein ID:NP_078878
Current member NCBI NM_024602.6 NP_078878.3 Accepted alive Link to Nucleotide Sequence:NM_024602.6Link to Protein Sequence:NP_078878.3Re-query CCDS DB by Nucleotide ID:NM_024602Re-query CCDS DB by Protein ID:NP_078878Link to BLAST:NP_078878.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_078878.3 861 Q5T447-1 861 100% 0 0

Chromosomal Locations for CCDS 41318.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 1 (NC_000001.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 45003492 45003576 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 45003669 45003740 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 45003855 45003936 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 45004060 45004134 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 45004248 45004377 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 45004600 45004806 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 45005794 45005883 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 45005997 45006116 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 45006692 45006795 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 45006951 45007015 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 45007219 45007271 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 45007413 45007595 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 45008240 45008321 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 45008536 45008701 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 45009144 45009226 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 45009369 45009482 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 45009568 45009683 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 45009986 45010121 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 45010201 45010293 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 45010546 45010706 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 45010889 45011257 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2586 nt):
ATGGCGGGTCCTGGCCCGGGCGCGGTGCTGGAGTCCCCCCGGCAGCTGCTGGGCCGCGTGCGCTTCTTGG
CA
GAGGCAGCGCGGAGCCTCCGCGCCGGGCGGCCGCTGCCAGCAGCGCTGGCTTTCGTGCCGCGAGAGGT
G
CTCTACAAGCTTTACAAGGACCCAGCGGGACCGTCGCGCGTGCTTCTGCCGGTGTGGGAGGCAGAGGGC
CTG
GGGCTGCGTGTGGGCGCCGCAGGCCCAGCCCCCGGTACCGGCTCCGGGCCCCTCCGCGCCGCCCGCG
AC
AGCATTGAGCTCCGGCGCGGCGCCTGCGTGCGCACCACGGGCGAGGAGCTGTGCAATGGCCACGGGCT
C
TGGGTGAAGCTGACAAAGGAGCAGCTGGCAGAGCACCTGGGCGACTGCGGGCTGCAGGAAGGCTGGCTG
CTG
GTGTGCCGCCCGGCGGAGGGCGGAGCCCGCCTGGTACCCATCGACACTCCCAACCACCTCCAGCGGC
AG
CAGCAGCTCTTTGGCGTGGATTATCGGCCGGTGCTCAGGTGGGAACAGGTGGTGGACCTGACATACTC
A
CATCGCCTGGGATCGAGACCTCAGCCGGCAGAGGCATACGCAGAAGCTGTACAAAGGCTACTCTATGTA
CCC
CCGACATGGACCTACGAGTGCGACGAGGACCTGATCCACTTCTTGTATGACCACCTGGGCAAGGAGG
AT
GAGAACCTGGGTAGCGTGAAGCAGTATGTGGAGAGCATAGACGTTTCCTCCTACACGGAGGAGTTCAA
C
GTGTCCTGCCTGACAGACAGCAATGCCGATACCTACTGGGAGAGCGATGGGTCCCAGTGCCAACACTGG
GTA
CGGCTTACTATGAAGAAGGGCACCATTGTCAAGAAGCTGCTACTCACAGTGGATACCACAGATGACA
AC
TTTATGCCAAAGCGGGTGGTGGTCTATGGGGGTGAAGGGGACAACCTGAAGAAGCTGAGTGACGTGAG
C
ATTGACGAGACCCTCATCGGGGATGTCTGTGTCCTGGAGGACATGACCGTCCACCTCCCGATCATCGAG
ATC
CGCATCGTGGAGTGCCGAGATGATGGGATTGATGTTCGTCTCCGAGGGGTCAAGATCAAGTCATCTA
GA
CAGCGGGAACTAGGGTTGAATGCAGACCTGTTCCAGCCAACTAGTCTGGTGCGATATCCACGCCTAGA
A
GGCACCGACCCTGAAGTACTGTACCGCAGAGCTGTCCTCCTGCAGAGATTCATCAAGATCCTCGATAGT
GTC
CTGCACCACCTGGTACCTGCCTGGGACCACACACTGGGCACCTTCAGTGAGATTAAGCAAGTGAAGC
AG
TTCCTACTGCTGTCCCGCCAGCGGCCAGGCCTGGTGGCTCAGTGCCTGCGTGACTCTGAGAGCAGCAA
G
CCCAGCTTCATGCCACGCCTATACATCAACCGCCGTCTTGCCATGGAACACCGTGCCTGCCCCTCTCGA
GAC
CCTGCCTGCAAGAATGCAGTCTTCACCCAGGTATATGAAGGCCTCAAGCCCTCTGACAAATATGAAA
AG
CCCCTGGACTACAGGTGGCCCATGCGCTATGACCAGTGGTGGGAGTGTAAATTTATTGCAGAAGGCAT
C
ATTGACCAAGGGGGTGGTTTCCGGGACAGCCTGGCAGATATGTCAGAAGAGCTGTGCCCTAGCTCAGCG
GAT
ACCCCCGTGCCCCTGCCCTTCTTTGTACGCACAGCCAACCAGGGCAATGGCACTGGTGAGGCTCGGG
AC
ATGTATGTACCCAACCCCTCCTGCCGAGACTTTGCCAAGTATGAATGGATCGGACAGCTGATGGGGGC
T
GCCCTTCGGGGTAAGGAGTTCCTGGTCCTGGCCCTGCCTGGTTTTGTGTGGAAGCAGCTTTCTGGTGAG
GAG
GTGAGCTGGAGCAAGGACTTCCCAGCTGTGGACTCTGTGCTGGTGAAGCTCCTGGAAGTGATGGAAG
GA
ATGGACAAGGAGACGTTTGAGTTCAAGTTTGGGAAGGAACTAACATTCACCACTGTACTGAGTGACCA
A
CAGGTGGTGGAGCTGATCCCTGGGGGTGCAGGCATCGTCGTGGGATATGGGGACCGTTCTCGTTTCATC
CAA
CTGGTCCAGAAGGCACGGCTAGAGGAGAGCAAGGAGCAGGTGGCAGCTATGCAGGCAGGTCTGCTGA
AG
GTGGTACCACAGGCTGTGCTGGACTTGCTGACCTGGCAAGAGTTGGAGAAGAAAGTGTGTGGGGATCC
A
GAGGTCACTGTGGATGCTCTGCGCAAGCTCACCCGGTTTGAGGACTTCGAGCCATCTGACTCGCGGGTG
CAG
TATTTCTGGGAGGCACTGAACAACTTCACCAACGAGGACCGGAGCCGCTTCCTGCGCTTTGTCACGG
GC
CGCAGTCGCCTGCCAGCACGGATCTACATCTACCCAGACAAGCTGGGCTACGAGACCACAGACGCGCT
G
CCCGAGTCTTCCACTTGCTCCAGCACCCTCTTCCTGCCACACTATGCCAGTGCCAAGGTATGCGAGGAG
AAG
CTCCGCTATGCGGCCTACAACTGCGTGGCCATCGACACTGACATGAGCCCTTGGGAGGAGTGA


Translation (861 aa):
MAGPGPGAVLESPRQLLGRVRFLAEAARSLRAGRPLPAALAFVPREVLYKLYKDPAGPSRVLLPVWEAEG
L
GLRVGAAGPAPGTGSGPLRAARDSIELRRGACVRTTGEELCNGHGLWVKLTK
EQLAEHLGDCGLQEGWL
L
VCRPAEGGARLVPIDTPNHLQRQQQLFGVDYRPVL
RWEQVVDLTYSHRLGSRPQPAEAYAEAVQRLLYV
P
PTWTYECDEDLIHFLYDHLGKEDENLGSVKQYVESIDVSSYT
EEFNVSCLTDSNADTYWESDGSQCQHW
V
RLTMKKGTIV
KKLLLTVDTTDDNFMPKRVVVYGGEGDNLKKLSDVSIDETLIGDVCVLEDMTVHLPIIE
I
RIVECR
DDGIDVRLRGVKIKSSRQRELGLNADLFQPTSLVRYPRLEGTDPEVLYRRAVLLQRFIKILDS
V
LHHLVPAWDHTLGTFSEIK
QVKQFLLLSRQRPGLVAQCLRDSESSKPSFMPRLYINRRLAMEHRACPSR
D
PACKNAVFTQ
VYEGLKPSDKYEKPLDYRWPMRYDQWWECKFIAEGIIDQGGGFRDSLADMSEELCPSSA
D
TPVPLPFFVRTANQ
GNGTGEARDMYVPNPSCRDFAKYEWIGQLMGAALRGKEFLVLALPGFVWKQLSGE
E
VSWSKDFPAVDSVL
VKLLEVMEGMDKETFEFKFGKELTFTTVLSDQQVVELIPGGAGIVVGYGDRSRFI
Q
LVQKARLEESKEQ
VAAMQAGLLKVVPQAVLDLLTWQELEKKVCGDPEVTVDALRKLTRFEDFEPSDSRV
Q
YFWEALNNFTN
EDRSRFLRFVTGRSRLPARIYIYPDKLGYETTDALPESSTCSSTLFLPHYASAKVCEE
K
LRYAAYNCVAIDTDMSPWEE




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser