NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS12165.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
12165.1 Public Homo sapiens 19 GTF2F1 22 109 92 CCDS HistoryNCBI Gene:2962Re-query CCDS DB by CCDS ID:12165.1Re-query CCDS DB by GeneID:2962See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 12165.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000394456.9 ENSP00000377969.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000394456.9Link to Ensembl Protein Viewer:ENSP00000377969.3Re-query CCDS DB by Nucleotide ID:ENST00000394456Re-query CCDS DB by Protein ID:ENSP00000377969
Original member NCBI NM_002096.2 NP_002087.2 Updated not alive Link to Nucleotide Sequence:NM_002096.2Link to Protein Sequence:NP_002087.2Re-query CCDS DB by Nucleotide ID:NM_002096Re-query CCDS DB by Protein ID:NP_002087
Current member NCBI NM_002096.3 NP_002087.2 Accepted alive Link to Nucleotide Sequence:NM_002096.3Link to Protein Sequence:NP_002087.2Re-query CCDS DB by Nucleotide ID:NM_002096Re-query CCDS DB by Protein ID:NP_002087Link to BLAST:NP_002087.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_002087.2 517 P35269 517 100% 0 0

Chromosomal Locations for CCDS 12165.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 19 (NC_000019.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 6380281 6380485 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 6380573 6380690 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 6380904 6381042 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 6381122 6381195 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 6381359 6381478 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 6381554 6381615 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 6381697 6381850 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 6383311 6383495 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 6387389 6387559 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 6389444 6389637 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 6391902 6391974 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 6392857 6392903 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 6392984 6392995 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1554 nt):
ATGGCGGCCCTAGGCCCTAGCAGCCAGAATGTCACTGAATACGTCGTTCGAGTTCCTAAGAATACAACCA
AA
AAATATAACATCATGGCTTTTAATGCAGCCGACAAAGTCAACTTTGCTACGTGGAATCAGGCTCGGCT
G
GAGCGGGACTTGAGCAACAAGAAAATCTACCAAGAGGAGGAGATGCCCGAATCGGGCGCGGGCAGTGAG
TTC
AACCGCAAGCTTCGGGAGGAGGCTCGGAGGAAGAAGTACGGCATCGTCCTCAAGGAGTTCCGGCCCG
AG
GACCAGCCCTGGCTGCTCCGGGTCAACGGCAAATCAGGCAGGAAGTTCAAGGGCATCAAGAAGGGAGG
C
GTAACAGAGAACACGTCCTACTACATCTTCACCCAGTGCCCCGACGGGGCCTTCGAGGCCTTCCCCGTG
CAC
AACTGGTACAATTTCACACCGCTGGCCCGGCATCGCACGCTCACTGCCGAGGAGGCCGAGGAGGAGT
GG
GAGAGGAGGAACAAGGTGCTGAACCACTTCAGCATCATGCAGCAGCGGCGGCTCAAGGATCAGGACCA
G
GACGAGGATGAGGAGGAGAAGGAGAAACGTGGCCGCAGGAAGGCGAGCGAGCTGCGCATCCACGACCTG
GAG
GACGACCTGGAGATGTCGTCCGATGCCAGTGATGCCAGTGGTGAGGAGGGGGGCAGAGTCCCCAAGG
CC
AAGAAGAAGGCGCCGCTGGCCAAGGGCGGCAGGAAAAAGAAGAAGAAGAAGGGTTCAGACGACGAGGC
C
TTCGAGGACAGCGATGATGGGGACTTCGAGGGCCAAGAGGTGGACTACATGTCAGACGGCTCCAGTAGC
TCC
CAAGAAGAGCCTGAGAGCAAGGCCAAGGCGCCGCAGCAGGAGGAGGGGCCCAAGGGTGTCGATGAGC
AG
AGCGACAGTAGTGAGGAGAGTGAGGAGGAGAAGCCGCCTGAGGAGGACAAGGAGGAGGAGGAGGAGAA
G
AAGGCACCCACCCCGCAGGAGAAGAAGCGCAGGAAAGACAGCAGCGAGGAGTCGGACAGCTCAGAGGAG
AGC
GACATTGACAGCGAGGCCTCCTCAGCCCTCTTCATGGCGAAGAAGAAGACGCCACCCAAGAGAGAGC
GG
AAGCCGTCGGGAGGGAGCTCAAGGGGCAACAGCCGCCCAGGCACGCCCAGCGCAGAGGGTGGCAGCAC
C
TCCTCCACCCTGCGGGCGGCTGCCAGCAAACTCGAGCAAGGGAAGCGGGTGAGCGAGATGCCTGCAGCC
AAG
CGGTTGCGGCTGGACACGGGACCCCAGAGCCTGTCTGGGAAGTCGACACCCCAGCCACCATCAGGCA
AG
ACAACACCCAACAGCGGCGACGTGCAGGTGACTGAGGATGCCGTGCGCCGCTACCTGACACGGAAGCC
C
ATGACCACTAAGGACCTGCTGAAAAAGTTCCAGACCAAGAAGACAGGGCTGAGCAGCGAGCAGACAGTG
AAC
GTGTTGGCCCAGATCCTCAAGCGACTCAACCCCGAGCGCAAGATGATCAACGACAAAATGCACTTCT
CC
CTCAAGGAGTGA


Translation (517 aa):
MAALGPSSQNVTEYVVRVPKNTTKKYNIMAFNAADKVNFATWNQARLERDLSNKKIYQEEEMPESGAGSE
F
NRKLREEARRKKYGIVLKEFRPEDQPWLLRVNGKSGR
KFKGIKKGGVTENTSYYIFTQCPDGAFEAFPV
H
NWYNFTPLARHRTLTAEEAEEEWE
RRNKVLNHFSIMQQRRLKDQDQDEDEEEKEKRGRRKASELRIHDL
E
DDLEMSSDASDASGEE
GGRVPKAKKKAPLAKGGRKKKKKKGSDDEAFEDSDDGDFEGQEVDYMSDGSSS
S
QEEPESKAKAPQQEEGPK
GVDEQSDSSEESEEEKPPEEDKEEEEEKKAPTPQEKKRRKDSSEESDSSEE
S
DIDSEASSALFMA
KKKTPPKRERKPSGGSSRGNSRPGTPSAEGGSTSSTLRAAASKLEQGKRVSEMPAA
K
RLRLDTGPQSLSGKSTPQPPSGKTTPNS
GDVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTV
N
VLAQILKRLNPERKMINDKMHFSLKE




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser