NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS1166.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
1166.1 Public Homo sapiens 1 FCRL4 20 108 85 CCDS HistoryNCBI Gene:83417Re-query CCDS DB by CCDS ID:1166.1Re-query CCDS DB by GeneID:83417See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 1166.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000271532 ENSP00000271532 Accepted alive Link to Ensembl Transcript Viewer:ENST00000271532Link to Ensembl Protein Viewer:ENSP00000271532Re-query CCDS DB by Nucleotide ID:ENST00000271532Re-query CCDS DB by Protein ID:ENSP00000271532
Original member Current member EBI,WTSI OTTHUMT00000086180 OTTHUMP00000033529 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000086180Link to Vega Protein Viewer:OTTHUMP00000033529Re-query CCDS DB by Nucleotide ID:OTTHUMT00000086180Re-query CCDS DB by Protein ID:OTTHUMP00000033529
Original member Current member NCBI NM_031282.2 NP_112572.1 Accepted alive Link to Nucleotide Sequence:NM_031282.2Link to Protein Sequence:NP_112572.1Re-query CCDS DB by Nucleotide ID:NM_031282Re-query CCDS DB by Protein ID:NP_112572Link to BLink:NP_112572.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_112572.1 515 Q96PJ5-1 515 100% 0 0

Chromosomal Locations for CCDS 1166.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '-' strand of Chromosome 1 (NC_000001.11)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 1Link to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 157575524 157575610 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 157575699 157575730 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 157578474 157578542 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 157578770 157578852 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 157580321 157580348 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 157581531 157581644 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 157586168 157586455 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 157587276 157587560 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 157587865 157588119 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 157589204 157589458 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 157596328 157596348 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 157597914 157597944 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1548 nt):
ATGCTGCTGTGGGCGTCCTTGCTGGCCTTTGCTCCAGTCTGTGGACAATCTGCAGCTGCACACAAACCTG
TG
ATTTCCGTCCATCCTCCATGGACCACATTCTTCAAAGGAGAGAGAGTGACTCTGACTTGCAATGGATT
T
CAGTTCTATGCAACAGAGAAAACAACATGGTATCATCGGCACTACTGGGGAGAAAAGTTGACCCTGACC
CCA
GGAAACACCCTCGAGGTTCGGGAATCTGGACTGTACAGATGCCAGGCCCGGGGCTCCCCACGAAGTA
AC
CCTGTGCGCTTGCTCTTTTCTTCAGACTCCTTAATCCTGCAGGCACCATATTCTGTGTTTGAAGGTGA
C
ACATTGGTTCTGAGATGCCACAGAAGAAGGAAAGAGAAATTGACTGCTGTGAAATATACTTGGAATGGA
AAC
ATTCTTTCCATTTCTAATAAAAGCTGGGATCTTCTTATCCCACAAGCAAGTTCAAATAACAATGGCA
AT
TATCGATGCATTGGATATGGAGACGAGAATGATGTATTTAGATCAAATTTCAAAATAATTAAAATTCA
A
GAACTATTTCCACATCCAGAGCTGAAAGCTACAGACTCTCAGCCTACAGAGGGGAATTCTGTAAACCTG
AGC
TGTGAAACACAGCTTCCTCCAGAGCGGTCAGACACCCCACTTCACTTCAACTTCTTCAGAGATGGCG
AG
GTCATCCTGTCAGACTGGAGCACGTACCCGGAACTCCAGCTCCCAACCGTCTGGAGAGAAAACTCAGG
A
TCCTATTGGTGTGGTGCTGAAACAGTGAGGGGTAACATCCACAAGCACAGTCCCTCGCTACAGATCCAT
GTG
CAGCGGATCCCTGTGTCTGGGGTGCTCCTGGAGACCCAGCCCTCAGGGGGCCAGGCTGTTGAAGGGG
AG
ATGCTGGTCCTTGTCTGCTCCGTGGCTGAAGGCACAGGGGATACCACATTCTCCTGGCACCGAGAGGA
C
ATGCAGGAGAGTCTGGGGAGGAAAACTCAGCGTTCCCTGAGAGCAGAGCTGGAGCTCCCTGCCATCAGA
CAG
AGCCATGCAGGGGGATACTACTGTACAGCAGACAACAGCTACGGCCCTGTCCAGAGCATGGTGCTGA
AT
GTCACTGTGAGAGAGACCCCAGGCAACAGAGATGGCCTTGTCGCCGCGGGAGCCACTGGAGGGCTGCT
C
AGTGCTCTTCTCCTGGCTGTGGCCCTGCTGTTTCACTGCTGGCGTCGGAGGAAGTCAGGAGTTGGTTTC
TTG
GGAGACGAAACCAGGCTCCCTCCCGCTCCAGGCCCAGGAGAGTCCTCCCATTCCATCTGCCCTGCCC
AG
GTGGAGCTTCAGTCGTTGTATGTTGATGTACACCCCAAAAAGGGAGATTTGGTATACTCTGAGATCCA
G
ACTACTCAGCTGGGAGAAGAAGAGGAAGCTAATACCTCCAGGACACTTCTAGAGGATAAGGATGTCTCA
GTT
GTCTACTCTGAGGTAAAGACACAACACCCAGATAACTCAGCTGGAAAGATCAGCTCTAAGGATGAAG
AA
AGTTAA


Translation (515 aa):
MLLWASLLAFAPVCGQSAAAHKPVISVHPPWTTFFKGERVTLTCNGFQFYATEKTTWYHRHYWGEKLTLT
P
GNTLEVRESGLYRCQARGSPRSNPVRLLFSS
DSLILQAPYSVFEGDTLVLRCHRRRKEKLTAVKYTWNG
N
ILSISNKSWDLLIPQASSNNNGNYRCIGYGDENDVFRSNFKIIKIQ
ELFPHPELKATDSQPTEGNSVNL
S
CETQLPPERSDTPLHFNFFRDGEVILSDWSTYPELQLPTVWRENSGSYWCGAETVRGNIHKHSPSLQIH
V
Q
RIPVSGVLLETQPSGGQAVEGEMLVLVCSVAEGTGDTTFSWHREDMQESLGRKTQRSLRAELELPAIR
Q
SHAGGYYCTADNSYGPVQSMVLNVTVR
ETPGNRDGLVAAGATGGLLSALLLAVALLFHCWRRRKSGVGF
L
GDET
RLPPAPGPGESSHSICPAQVELQSLYVDVHPKKGDLVYSEIQTTQLGEEEEANTSRTLLEDKDVS
V
VYSEVKTQHPDNSAGKISSKDEES




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser