NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS4033.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
4033.1 Public Homo sapiens 5 F2RL1 22 109 92 CCDS HistoryNCBI Gene:2150Re-query CCDS DB by CCDS ID:4033.1Re-query CCDS DB by GeneID:2150See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 4033.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000296677.4 ENSP00000296677.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000296677.4Link to Ensembl Protein Viewer:ENSP00000296677.4Re-query CCDS DB by Nucleotide ID:ENST00000296677Re-query CCDS DB by Protein ID:ENSP00000296677
Original member NCBI NM_005242.5 NP_005233.3 Updated not alive Link to Nucleotide Sequence:NM_005242.5Link to Protein Sequence:NP_005233.3Re-query CCDS DB by Nucleotide ID:NM_005242Re-query CCDS DB by Protein ID:NP_005233
Current member NCBI NM_005242.6 NP_005233.4 Accepted alive Link to Nucleotide Sequence:NM_005242.6Link to Protein Sequence:NP_005233.4Re-query CCDS DB by Nucleotide ID:NM_005242Re-query CCDS DB by Protein ID:NP_005233Link to BLAST:NP_005233.4

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_005233.4 397 P55085 397 99.7481% 0 1

Chromosomal Locations for CCDS 4033.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 5 (NC_000005.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 76819183 76819264 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 76832690 76833801 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1194 nt):
ATGCGGAGCCCCAGCGCGGCGTGGCTGCTGGGGGCCGCCATCCTGCTAGCAGCCTCTCTCTCCTGCAGTG
GC
ACCATCCAAGGAACCAGTAGATCCTCTAAAGGAAGAAGCCTTATTGGTAAGGTTGATGGCACATCCCA
C
GTCACTGGAAAAGGAGTTACAGTTGAAACAGTCTTTTCTGTGGATGAGTTTTCTGCATCTGTCCTCACT
GGA
AAACTGACCACTGTCTTCCTTCCAATTGTCTACACAATTGTGTTTGTGGTGGGTTTGCCAAGTAACG
GC
ATGGCCCTGTGGGTCTTTCTTTTCCGAACTAAGAAGAAGCACCCTGCTGTGATTTACATGGCCAATCT
G
GCCTTGGCTGACCTCCTCTCTGTCATCTGGTTCCCCTTGAAGATTGCCTATCACATACATGGCAACAAC
TGG
ATTTATGGGGAAGCTCTTTGTAATGTGCTTATTGGCTTTTTCTATGGCAACATGTACTGTTCCATTC
TC
TTCATGACCTGCCTCAGTGTGCAGAGGTATTGGGTCATCGTGAACCCCATGGGGCACTCCAGGAAGAA
G
GCAAACATTGCCATTGGCATCTCCCTGGCAATATGGCTGCTGATTCTGCTGGTCACCATTCCTTTGTAT
GTC
GTGAAGCAGACCATCTTCATTCCTGCCCTGAACATCACGACCTGTCATGATGTTTTGCCTGAGCAGC
TC
TTGGTGGGAGACATGTTCAATTACTTCCTCTCTCTGGCCATTGGGGTCTTTCTGTTCCCAGCCTTCCT
C
ACAGCCTCTGCCTATGTGCTGATGATCAGAATGCTGCGATCTTCTGCCATGGATGAAAACTCAGAGAAG
AAA
AGGAAGAGGGCCATCAAACTCATTGTCACTGTCCTGGCCATGTACCTGATCTGCTTCACTCCTAGTA
AC
CTTCTGCTTGTGGTGCATTATTTTCTGATTAAGAGCCAGGGCCAGAGCCATGTCTATGCCCTGTACAT
T
GTAGCCCTCTGCCTCTCTACCCTTAACAGCTGCATCGACCCCTTTGTCTATTACTTTGTTTCACATGAT
TTC
AGGGATCATGCAAAGAACGCTCTCCTTTGCCGAAGTGTCCGCACTGTAAAGCAGATGCAAGTATCCC
TC
ACCTCAAAGAAACACTCCAGGAAATCCAGCTCTTACTCTTCAAGTTCAACCACTGTTAAGACCTCCTA
T
TGA


Translation (397 aa):
MRSPSAAWLLGAAILLAASLSCSGTIQGTSRSSKGRSLIGKVDGTSHVTGKGVTVETVFSVDEFSASVLT
G
KLTTVFLPIVYTIVFVVGLPSNGMALWVFLFRTKKKHPAVIYMANLALADLLSVIWFPLKIAYHIHGNN
W
IYGEALCNVLIGFFYGNMYCSILFMTCLSVQRYWVIVNPMGHSRKKANIAIGISLAIWLLILLVTIPLY
V
VKQTIFIPALNITTCHDVLPEQLLVGDMFNYFLSLAIGVFLFPAFLTASAYVLMIRMLRSSAMDENSEK
K
RKRAIKLIVTVLAMYLICFTPSNLLLVVHYFLIKSQGQSHVYALYIVALCLSTLNSCIDPFVYYFVSHD
F
RDHAKNALLCRSVRTVKQMQVSLTSKKHSRKSSSYSSSSTTVKTSY




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser