NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS2367.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
2367.1 Public Homo sapiens 2 EEF1B2 22 109 92 CCDS HistoryNCBI Gene:1933Re-query CCDS DB by CCDS ID:2367.1Re-query CCDS DB by GeneID:1933See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 2367.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000236957.9 ENSP00000236957.5 Accepted alive Link to Ensembl Transcript Viewer:ENST00000236957.9Link to Ensembl Protein Viewer:ENSP00000236957.5Re-query CCDS DB by Nucleotide ID:ENST00000236957Re-query CCDS DB by Protein ID:ENSP00000236957
Original member Current member EBI,WTSI ENST00000392221.5 ENSP00000376055.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000392221.5Link to Ensembl Protein Viewer:ENSP00000376055.1Re-query CCDS DB by Nucleotide ID:ENST00000392221Re-query CCDS DB by Protein ID:ENSP00000376055
Original member Current member EBI,WTSI ENST00000392222.6 ENSP00000376056.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000392222.6Link to Ensembl Protein Viewer:ENSP00000376056.2Re-query CCDS DB by Nucleotide ID:ENST00000392222Re-query CCDS DB by Protein ID:ENSP00000376056
Original member Current member NCBI NM_001037663.1 NP_001032752.1 Accepted alive Link to Nucleotide Sequence:NM_001037663.1Link to Protein Sequence:NP_001032752.1Re-query CCDS DB by Nucleotide ID:NM_001037663Re-query CCDS DB by Protein ID:NP_001032752Link to BLAST:NP_001032752.1
Original member NCBI NM_001959.3 NP_001950.1 Updated not alive Link to Nucleotide Sequence:NM_001959.3Link to Protein Sequence:NP_001950.1Re-query CCDS DB by Nucleotide ID:NM_001959Re-query CCDS DB by Protein ID:NP_001950
Current member NCBI NM_001959.4 NP_001950.1 Accepted alive Link to Nucleotide Sequence:NM_001959.4Link to Protein Sequence:NP_001950.1Re-query CCDS DB by Nucleotide ID:NM_001959Re-query CCDS DB by Protein ID:NP_001950Link to BLAST:NP_001950.1
Original member Current member NCBI NM_021121.3 NP_066944.1 Accepted alive Link to Nucleotide Sequence:NM_021121.3Link to Protein Sequence:NP_066944.1Re-query CCDS DB by Nucleotide ID:NM_021121Re-query CCDS DB by Protein ID:NP_066944Link to BLAST:NP_066944.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001032752.1 225 P24534 225 100% 0 0
NP_001950.1 225 P24534 225 100% 0 0
NP_066944.1 225 P24534 225 100% 0 0

Chromosomal Locations for CCDS 2367.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 2 (NC_000002.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 206159980 206160059 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 206160588 206160710 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 206161346 206161472 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 206162038 206162104 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 206162489 206162614 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 206162729 206162883 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (678 nt):
ATGGGTTTCGGAGACCTGAAAAGCCCTGCCGGCCTCCAGGTGCTCAACGATTACCTGGCGGACAAGAGCT
AC
ATCGAGGGGTATGTGCCATCACAAGCAGATGTGGCAGTATTTGAAGCCGTGTCCAGCCCACCGCCTGC
C
GACTTGTGTCATGCCCTACGTTGGTATAATCACATCAAGTCTTACGAAAAGGAAAAGGCCAGCCTGCCA
GGA
GTGAAGAAAGCTTTGGGCAAATATGGTCCTGCCGATGTGGAAGACACTACAGGAAGTGGAGCTACAG
AT
AGTAAAGATGATGATGACATTGACCTCTTTGGATCTGATGATGAGGAGGAAAGTGAAGAAGCAAAGAG
G
CTAAGGGAAGAACGTCTTGCACAATATGAATCAAAGAAAGCCAAAAAACCTGCACTTGTTGCCAAGTCT
TCC
ATCTTACTAGATGTGAAACCTTGGGATGATGAGACAGATATGGCGAAATTAGAGGAGTGCGTCAGAA
GC
ATTCAAGCAGACGGCTTAGTCTGGGGCTCATCTAAACTAGTTCCAGTGGGATACGGAATTAAGAAACT
T
CAAATACAGTGTGTAGTTGAAGATGATAAAGTTGGAACAGATATGCTGGAGGAGCAGATCACTGCTTTT
GAG
GACTATGTGCAGTCCATGGATGTGGCTGCTTTCAACAAGATCTAA


Translation (225 aa):
MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLP
G
VKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEE
ESEEAKRLREERLAQYESKKAKKPALVAKS
S
ILLDVKPWDDETDMAKLEECVRSIQADGLVWGS
SKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAF
E
DYVQSMDVAAFNKI




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser